KEGG   Methanococcus aeolicus: Maeo_1006Help
Entry
Maeo_1006         CDS       T00552                                 

Definition
pyruvate carboxylase subunit A (EC:6.4.1.1)
Orthology
K01959  
pyruvate carboxylase subunit A [EC:6.4.1.1]
Organism
mae  Methanococcus aeolicus
Pathway
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:mae01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:mae01230]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:mae00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mae00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1031751..1033280
Genome map
AA seq 509 aa AA seqDB search
MFKKILIANRGEIAVRIIRACQELDIKTVAIYSEADENALYTSIADECYCIGPPQASKSY
LNLDMIVHVAKKTGAEAIHPGYGFLSENLEFAKACENNGIVFIGPPSEAIDAMGSKINAK
KIMKNANVPVLPGREEPIEDPEEVVEIAEEIGYPVIIKASAGGGGMGMAVAYNKQELKEV
VESTKSIAQSAFGDSTVFIEKYLENPRHIEIQVLGDKYGNVVHLGDRECSIQRRHQKLIE
EAPSPIMTEELRKKMGDAAISAAKAINYYSAGTVEFLYDNGEFYFLEMNTRVQVEHPITE
IITGVDIVKEQIKIAYGEKLPFKQEDIVIRGHAMECRINAEDPVNDFVPTPGVIKHYRSP
GGPGIRIDSGVYAGAEIPPYYDSLISKFISYGNDRDEAIARMKRALSEYIIIGLTTNIPF
HRAVMDELDFKNGNISTHYIEEHSEYLKENIMKYAIEAKDEEKLYADKIFGKNKQVVAIA
GGLNAYISSVVASNKNIDKCDEKYSEEQN
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaaaaatattaatcgccaacagaggagaaattgctgttagaattattagagca
tgtcaggaattagacataaaaaccgtagcaatttattctgaagccgatgaaaatgcatta
tatacttcaatagccgatgaatgttattgtatcggccctccacaagcttcaaaaagttat
cttaatcttgatatgatagtccatgtagcaaagaaaacaggtgcagaagcaattcaccca
ggatatggttttttatctgaaaatttggaatttgccaaagcatgtgagaataatggaata
gtatttattggacctccgtcggaagccatagatgccatgggtagcaaaataaatgctaaa
aaaataatgaaaaatgccaatgttccagttctccctggaagggaagaaccaattgaagac
cccgaagaggttgttgaaattgcagaagaaattggctaccctgtaattattaaagcctcc
gcaggtggtggaggtatgggaatggccgtggcatacaataaacaagaattaaaagaagtg
gtagagtccacaaagtcaatagctcaaagtgcatttggggattccactgtatttattgaa
aaatatttggaaaacccaagacatattgaaatccaagtattgggagataaatacggaaat
gtagttcatttgggagatagggagtgttccattcagagaagacatcaaaaacttattgaa
gaagctccatctccaataatgacagaagaattaagaaaaaaaatgggggatgctgcaatt
tcagcagcaaaagctataaactattatagtgccggaactgtggaattcttatacgataat
ggagaattttattttttggaaatgaatacaagagttcaagttgaacatccaattacagaa
attatcacaggagtagatattgtaaaggaacaaataaaaatagcatatggggaaaaatta
ccgttcaaacaagaggacattgtaattagaggacatgctatggaatgcagaataaatgca
gaagaccccgtaaatgattttgttcctactcccggggtaattaaacattataggtcccca
ggaggcccgggaattagaatagatagtggcgtctatgccggtgcagaaattcctccatat
tatgattcattaatatctaaattcatatcctatggaaatgatagagatgaagcaatagca
agaatgaaaagagcattatccgaatatattattatcggacttaccacaaatataccattc
catagggcagttatggacgaattagactttaaaaatggaaatatatccacccattatatt
gaagaacattcagaatatttaaaagaaaatataatgaaatatgccattgaagctaaggac
gaagaaaaattatatgccgataaaatatttggaaaaaacaaacaagttgtagcaattgca
ggtggattaaatgcatatatttcaagtgttgtagcttcaaataaaaatatagataaatgc
gatgaaaaatattcagaagagcaaaattaa

DBGET integrated database retrieval system