KEGG   Methanococcus aeolicus: Maeo_1120Help
Entry
Maeo_1120         CDS       T00552                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mae  Methanococcus aeolicus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mae00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Maeo_1120
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Maeo_1120
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Maeo_1120
Enzymes [BR:mae01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Maeo_1120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1165132..1166301
Genome map
AA seq 389 aa AA seqDB search
MEYKFGEYGGQYVPEVLMPSLKELEKAYKKYKDDPEFKEELEYYLKQYAGRETPLYFAEN
LTKKMGGAKIYLKREDLLLGGAHKINNSLGQALLAKRIGKTRIIAETGAGEHGLSTAMVG
ALFGLKAKIYMGAVDVERQKLNVYKMRLHGAEVHAVQSGSKTLKDAINEALRDWVETFED
THYIIGSAVGPYPFPSMVRDFQSVIGKEAKKQILEAEGRLPDSIVACVGGGSNSIGIFNE
FKQDKEVKLIGVEAAGEGLDTDRHGAAILKGKKGVLHGMLSKFLQDDDGQIAETYSISAG
LDYPGVGPEHAYLDEIKRVEYAGITDVEALDAFSTLSKTEGIIPALESSHAVAHGMKIAK
EMDKDEIIIINLSGRGDKDIHTVMNFIEF
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggaatataaattcggagaatatggaggtcaatatgtgcctgaggtgcttatgccgtca
ttaaaagaattggaaaaagcatataaaaaatacaaagatgacccagaatttaaagaagag
cttgaatactacttaaaacaatatgctggaagggagaccccattatattttgctgaaaac
ctaacaaaaaagatgggaggagctaaaatatacctaaaaagagaggatttattattgggg
ggagctcacaaaataaacaatagtttaggacaggcactacttgctaaaagaataggcaaa
acaagaattattgccgaaacaggagcaggagaacatgggctatctacggcaatggttgga
gctctatttggacttaaagctaaaatatatatgggagcagtagatgttgaaagacaaaaa
ttaaatgtttataaaatgaggttgcacggtgcagaggttcatgccgttcaatctggttca
aaaacattaaaagatgccataaatgaagcacttagagattgggttgagacctttgaagat
acccattatattattggttcagctgttggtccttatccattcccttcaatggttagagat
ttccagtcagtaattggtaaagaagctaaaaagcaaatattagaggcagaaggacgactt
ccagatagtattgtagcttgtgtggggggaggaagtaattctattggaatatttaatgaa
tttaaacaggataaagaagttaaattaattggtgttgaggcagcgggtgaaggacttgac
acagataggcacggagcagcaatattaaaaggtaaaaagggagttttacatggtatgcta
tccaagtttttacaagatgatgatggacaaatagccgaaacatacagtatttccgcaggt
ttagattatccaggagtaggtccagaacatgcttatttagatgaaattaaaagagtagaa
tatgcaggaattaccgatgttgaggcacttgatgctttttcaacattgtcaaaaaccgaa
ggaattatcccagctcttgaatcttcccatgctgttgcccatggtatgaaaattgccaaa
gaaatggataaagatgaaataattattattaatttatcgggcagaggagataaagacata
cataccgttatgaatttcattgagttttaa

DBGET integrated database retrieval system