KEGG   Methanococcus aeolicus: Maeo_1120Help
Entry
Maeo_1120         CDS       T00552                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mae  Methanococcus aeolicus
Pathway
mae00260  Glycine, serine and threonine metabolism
mae00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mae01100  Metabolic pathways
mae01110  Biosynthesis of secondary metabolites
mae01130  Biosynthesis of antibiotics
mae01230  Biosynthesis of amino acids
Module
mae_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mae00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Maeo_1120
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Maeo_1120
Enzymes [BR:mae01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Maeo_1120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABR56697
JGI: Maeo1120
UniProt: A6UW25
Position
1165132..1166301
Genome map
AA seq 389 aa AA seqDB search
MEYKFGEYGGQYVPEVLMPSLKELEKAYKKYKDDPEFKEELEYYLKQYAGRETPLYFAEN
LTKKMGGAKIYLKREDLLLGGAHKINNSLGQALLAKRIGKTRIIAETGAGEHGLSTAMVG
ALFGLKAKIYMGAVDVERQKLNVYKMRLHGAEVHAVQSGSKTLKDAINEALRDWVETFED
THYIIGSAVGPYPFPSMVRDFQSVIGKEAKKQILEAEGRLPDSIVACVGGGSNSIGIFNE
FKQDKEVKLIGVEAAGEGLDTDRHGAAILKGKKGVLHGMLSKFLQDDDGQIAETYSISAG
LDYPGVGPEHAYLDEIKRVEYAGITDVEALDAFSTLSKTEGIIPALESSHAVAHGMKIAK
EMDKDEIIIINLSGRGDKDIHTVMNFIEF
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggaatataaattcggagaatatggaggtcaatatgtgcctgaggtgcttatgccgtca
ttaaaagaattggaaaaagcatataaaaaatacaaagatgacccagaatttaaagaagag
cttgaatactacttaaaacaatatgctggaagggagaccccattatattttgctgaaaac
ctaacaaaaaagatgggaggagctaaaatatacctaaaaagagaggatttattattgggg
ggagctcacaaaataaacaatagtttaggacaggcactacttgctaaaagaataggcaaa
acaagaattattgccgaaacaggagcaggagaacatgggctatctacggcaatggttgga
gctctatttggacttaaagctaaaatatatatgggagcagtagatgttgaaagacaaaaa
ttaaatgtttataaaatgaggttgcacggtgcagaggttcatgccgttcaatctggttca
aaaacattaaaagatgccataaatgaagcacttagagattgggttgagacctttgaagat
acccattatattattggttcagctgttggtccttatccattcccttcaatggttagagat
ttccagtcagtaattggtaaagaagctaaaaagcaaatattagaggcagaaggacgactt
ccagatagtattgtagcttgtgtggggggaggaagtaattctattggaatatttaatgaa
tttaaacaggataaagaagttaaattaattggtgttgaggcagcgggtgaaggacttgac
acagataggcacggagcagcaatattaaaaggtaaaaagggagttttacatggtatgcta
tccaagtttttacaagatgatgatggacaaatagccgaaacatacagtatttccgcaggt
ttagattatccaggagtaggtccagaacatgcttatttagatgaaattaaaagagtagaa
tatgcaggaattaccgatgttgaggcacttgatgctttttcaacattgtcaaaaaccgaa
ggaattatcccagctcttgaatcttcccatgctgttgcccatggtatgaaaattgccaaa
gaaatggataaagatgaaataattattattaatttatcgggcagaggagataaagacata
cataccgttatgaatttcattgagttttaa

DBGET integrated database retrieval system