KEGG   Methanococcus aeolicus: Maeo_1122Help
Entry
Maeo_1122         CDS       T00552                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mae  Methanococcus aeolicus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mae00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Maeo_1122
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Maeo_1122
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Maeo_1122
Enzymes [BR:mae01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Maeo_1122
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1167230..1167982
Genome map
AA seq 250 aa AA seqDB search
MDKKLVSFIVAGDPNTEATIKYMKALAKYSDIIELGIPFSDPMADGSAIQQADIRALNNG
MKVSKVFDIIKEFRKTNSTPIVVMTYYNPVYFRGVENFIKSLKEAGGDGLIVVDLPVEDA
TDYLNICKKYNIKTVFLGAPNTTEERLKKIDDASSLFVYLVSVYGTTGTREGVSEEALNF
LKNTKKVCKNPIYVGFGISKKEHVESFVNNGADGVIVGSAYVKIIEEFGDSEETIKRLEA
KAKELKEGTK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggataaaaaacttgttagcttcattgttgcaggtgacccaaatacagaggctacaata
aaatatatgaaggctctggcaaagtattccgatattatagagttaggaataccatttagc
gacccgatggctgatggaagtgcaatacaacaggccgacattagggcattaaataatgga
atgaaagtttcgaaggtatttgatataataaaagaatttagaaaaaccaactccacccca
attgtggtaatgacatactacaacccggtttattttagaggagttgaaaactttataaaa
tcacttaaagaagcgggaggagatgggcttattgtggtagatttaccagttgaagatgca
acagattatttaaatatatgtaaaaaatacaatattaaaacagttttccttggagctccg
aatacaacagaggagagactaaaaaagattgatgatgcaagttcattatttgtatatctt
gtatctgtttatggaacaacaggaactagggagggagtttcagaagaagctttaaacttt
ttgaaaaatacaaaaaaagtatgtaaaaacccgatttatgttggatttggaatttctaaa
aaggaacatgttgaatcgtttgtaaataatggtgccgatggagttattgtaggtagtgcc
tatgtaaaaataatagaagagttcggagattcagaagaaactataaaaaggcttgaagcg
aaagctaaggaattaaaagaaggcactaaataa

DBGET integrated database retrieval system