KEGG   Methanococcus aeolicus: Maeo_1122Help
Entry
Maeo_1122         CDS       T00552                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mae  Methanococcus aeolicus
Pathway
mae00260  Glycine, serine and threonine metabolism
mae00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mae01100  Metabolic pathways
mae01110  Biosynthesis of secondary metabolites
mae01130  Biosynthesis of antibiotics
mae01230  Biosynthesis of amino acids
Module
mae_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mae00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Maeo_1122
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Maeo_1122
Enzymes [BR:mae01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Maeo_1122
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB TMP-TENI Peripla_BP_6 NMO IMPDH
Motif
Other DBs
NCBI-ProteinID: ABR56699
JGI: Maeo1122
UniProt: A6UW27
Position
1167230..1167982
Genome map
AA seq 250 aa AA seqDB search
MDKKLVSFIVAGDPNTEATIKYMKALAKYSDIIELGIPFSDPMADGSAIQQADIRALNNG
MKVSKVFDIIKEFRKTNSTPIVVMTYYNPVYFRGVENFIKSLKEAGGDGLIVVDLPVEDA
TDYLNICKKYNIKTVFLGAPNTTEERLKKIDDASSLFVYLVSVYGTTGTREGVSEEALNF
LKNTKKVCKNPIYVGFGISKKEHVESFVNNGADGVIVGSAYVKIIEEFGDSEETIKRLEA
KAKELKEGTK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggataaaaaacttgttagcttcattgttgcaggtgacccaaatacagaggctacaata
aaatatatgaaggctctggcaaagtattccgatattatagagttaggaataccatttagc
gacccgatggctgatggaagtgcaatacaacaggccgacattagggcattaaataatgga
atgaaagtttcgaaggtatttgatataataaaagaatttagaaaaaccaactccacccca
attgtggtaatgacatactacaacccggtttattttagaggagttgaaaactttataaaa
tcacttaaagaagcgggaggagatgggcttattgtggtagatttaccagttgaagatgca
acagattatttaaatatatgtaaaaaatacaatattaaaacagttttccttggagctccg
aatacaacagaggagagactaaaaaagattgatgatgcaagttcattatttgtatatctt
gtatctgtttatggaacaacaggaactagggagggagtttcagaagaagctttaaacttt
ttgaaaaatacaaaaaaagtatgtaaaaacccgatttatgttggatttggaatttctaaa
aaggaacatgttgaatcgtttgtaaataatggtgccgatggagttattgtaggtagtgcc
tatgtaaaaataatagaagagttcggagattcagaagaaactataaaaaggcttgaagcg
aaagctaaggaattaaaagaaggcactaaataa

DBGET integrated database retrieval system