KEGG   Methanococcus aeolicus: Maeo_1276Help
Entry
Maeo_1276         CDS       T00552                                 

Definition
tetrahydromethanopterin S-methyltransferase subunit H (EC:2.1.1.86)
Orthology
K00584  
tetrahydromethanopterin S-methyltransferase subunit H [EC:2.1.1.86]
Organism
mae  Methanococcus aeolicus
Pathway
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Methanogenesis, CO2 => methane
Methanogen
Class
Metabolism; Overview; Carbon metabolism [PATH:mae01200]
Metabolism; Energy metabolism; Methane metabolism [PATH:mae00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1337825..1338784
Genome map
AA seq 319 aa AA seqDB search
MFKFDKEQMVIEIAGRKFGGQPGEYPTGLSGTIFYARHKIVEDEIKGIFDKSAAEALINK
QAEMEDTTGNPALVQVFGGNPEALTKYIDFVAEVWDGPMLLDSTSGEARMAAATRATEAG
YANQCIYNSINVSIDEAEFQNLVESDIEASIVLCFDPMDPSVEGKLNVLLDGGKTTDTGM
LDLAEKAGIKYPLIDVACTPLGSGAGQSVRASFAVKAKLGLPVGSGIHNIPSAWDWLRDF
RKGLREAGQTQLAKDVHHVCDIGANIVQTMGSGDFVLYGPIDNAELAFPAVAMTDMVIAE
TAKDMGTVPVDTHPINKLL
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaatttgataaagaacagatggttattgaaatcgcaggtagaaaattcggcggt
cagccgggagaatacccaacaggtctatctggaacaatattttatgcaagacacaaaatt
gtagaagatgaaataaaagggattttcgataaatccgcagcagaagcattaataaacaaa
caagctgaaatggaagacaccacaggaaaccctgcattagttcaggtatttggtggaaac
ccagaggcattaacaaaatatatcgacttcgtagctgaagtatgggatggtccaatgtta
ttggactccacatcaggagaagctagaatggcagccgctacaagggcaaccgaagcagga
tatgcaaatcaatgtatttacaactctatcaatgtttcaatagatgaggcagaattccaa
aacttggtagaaagtgatatagaagcttccattgtgttgtgtttcgacccaatggaccca
tcagttgaaggtaaattaaatgtgttgttagatggtggaaaaacaacagatacaggtatg
cttgatttagctgaaaaagcgggaattaaatacccattaattgatgttgcatgtactcca
ttaggaagtggtgcaggtcagtctgtaagggcatcattcgctgttaaagcaaaattaggt
cttccagtaggtagtggtatccacaacatcccatcagcatgggactggttaagagatttc
agaaaaggattaagagaagcaggacaaacccaattagcaaaagatgttcatcatgtttgt
gatattggagctaatattgttcaaacaatgggttccggagactttgttttatacggacct
attgacaatgcagaattagcattcccagcagttgctatgaccgatatggttattgcagaa
acagcaaaagatatgggaacagttccagtagatacccatccaataaacaaattgttataa

DBGET integrated database retrieval system