KEGG   Methanococcus aeolicus: Maeo_1281Help
Entry
Maeo_1281         CDS       T00552                                 

Definition
(GenBank) pyruvate/ketoisovalerate oxidoreductase, gamma subunit
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
mae  Methanococcus aeolicus
Pathway
mae00010  Glycolysis / Gluconeogenesis
mae00020  Citrate cycle (TCA cycle)
mae00620  Pyruvate metabolism
mae00633  Nitrotoluene degradation
mae00640  Propanoate metabolism
mae00650  Butanoate metabolism
mae00680  Methane metabolism
mae00720  Carbon fixation pathways in prokaryotes
mae01100  Metabolic pathways
mae01120  Microbial metabolism in diverse environments
mae01130  Biosynthesis of antibiotics
mae01200  Carbon metabolism
Module
mae_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
mae_M00620  Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mae00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Maeo_1281
   00020 Citrate cycle (TCA cycle)
    Maeo_1281
   00620 Pyruvate metabolism
    Maeo_1281
   00640 Propanoate metabolism
    Maeo_1281
   00650 Butanoate metabolism
    Maeo_1281
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Maeo_1281
   00680 Methane metabolism
    Maeo_1281
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Maeo_1281
Enzymes [BR:mae01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Maeo_1281
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR
Motif
Other DBs
NCBI-ProteinID: ABR56857
JGI: Maeo1281
UniProt: A6UWI5
Position
1341536..1342063
Genome map
AA seq 175 aa AA seqDB search
MIEVRFHGRGGQGAVTAAQLLAKATFIDGNFAQAFPFFGVERRGAPVIAFTRIDDKKIRI
RSQIYEPDYVVVQDPSLLDSIDVKSGLKEGGKIIINTTKDIKFEGYDVFCVDATGIALDV
LGLPIVNTSILGAFAGVTGEVSIEALKEAIMDSFPKKLAEKNAKAAEVAYNAVKK
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgatagaagttagatttcacgggcgaggaggacaaggagccgtaaccgcagcacagctt
ttagcaaaagcaacctttatagatggaaattttgcccaagcatttccatttttcggtgtt
gagagaaggggagctccggttatagctttcacaagaatcgacgataaaaaaataagaata
agaagtcagatatatgaaccagattatgttgtagttcaagacccctctttattggattct
atagatgtaaaaagtggattaaaagaaggcggtaaaataattataaacaccacaaaggac
ataaaatttgagggatatgatgtattctgtgtggacgcaacaggaattgcacttgatgtg
ttaggattacctatcgtaaatacatcaatattgggggcattcgcaggagtgactggagaa
gtgagtatagaagcactcaaagaagctataatggattcattccctaaaaaattagctgag
aaaaacgcaaaagcagcagaagttgcatacaatgccgttaaaaagtaa

DBGET integrated database retrieval system