KEGG   Methanococcus aeolicus: Maeo_1282Help
Entry
Maeo_1282         CDS       T00552                                 

Definition
(GenBank) pyruvate ferredoxin/flavodoxin oxidoreductase, delta subunit
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
mae  Methanococcus aeolicus
Pathway
mae00010  Glycolysis / Gluconeogenesis
mae00020  Citrate cycle (TCA cycle)
mae00620  Pyruvate metabolism
mae00633  Nitrotoluene degradation
mae00640  Propanoate metabolism
mae00650  Butanoate metabolism
mae00680  Methane metabolism
mae00720  Carbon fixation pathways in prokaryotes
mae01100  Metabolic pathways
mae01120  Microbial metabolism in diverse environments
mae01130  Biosynthesis of antibiotics
mae01200  Carbon metabolism
Module
mae_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
mae_M00620  Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mae00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Maeo_1282
   00020 Citrate cycle (TCA cycle)
    Maeo_1282
   00620 Pyruvate metabolism
    Maeo_1282
   00640 Propanoate metabolism
    Maeo_1282
   00650 Butanoate metabolism
    Maeo_1282
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Maeo_1282
   00680 Methane metabolism
    Maeo_1282
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Maeo_1282
Enzymes [BR:mae01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Maeo_1282
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_21 Fer4_6 Fer4_10 Fer4_7 Fer4_9 Fer4_2 Fer4_16 Fer4_15 Fer4_17 Fer4_8 Fer4_13 Fer4_4 Fer4_3
Motif
Other DBs
NCBI-ProteinID: ABR56858
JGI: Maeo1282
UniProt: A6UWI6
Position
1342131..1342391
Genome map
AA seq 86 aa AA seqDB search
MTTIGAIIYEPGSSRNNKTGSWRVFIPTMDSDKCIMCENCFIFCPDSSIIEGEDGKFKID
YDYCKGCLICVEECPVNAVTSAREEK
NT seq 261 nt NT seq  +upstreamnt  +downstreamnt
atgactacaatcggtgctataatatatgaaccagggagctcccgaaataataaaactgga
agttggagggtatttatacctacaatggatagcgataaatgtattatgtgcgagaattgc
tttatattttgtccagattcctcaattatagagggcgaagatggtaaatttaaaatagat
tatgattattgcaaagggtgtttgatttgtgtagaagaatgtccagttaatgcagtaacc
agtgcaagggaagagaaataa

DBGET integrated database retrieval system