KEGG   Methanococcus aeolicus: Maeo_1446Help
Entry
Maeo_1446         CDS       T00552                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
mae  Methanococcus aeolicus
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:mae00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Maeo_1446
Enzymes [BR:mae01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Maeo_1446
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1502892..1503731
Genome map
AA seq 279 aa AA seqDB search
MYFEDFSKFICAYDDFEDSLYTIFGAPYDGTTSYKPGARFGADEIRKASWGLETYSPILK
KDLVDVPICDLHNISVDGTQKDIMKYIYEASKNSMKNNKIPIMLGGEHSITYPVVKSAKK
KYDDILLIQFDAHCDLRENYLNNKYSHASVIRRCFDLTKDIYQFGIRSGDEEEWEFGEKN
TNISMELPTKEDINIIKELDKKIYITIDIDVLDPAFAPGTGTPEPCGFSSKELMNSLYLF
KELKDNIIGFDVVEVSPHYDAGNITSIMGAKIVRELILL
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgtattttgaagatttttctaaatttatatgcgcttatgatgattttgaagatagttta
tatacaatattcggagctccatatgatggtacaacatcatataagccaggggcaagattt
ggagcagatgagataagaaaagcatcatggggattggagacatatagcccaatattaaaa
aaggatttggttgatgttcccatatgtgatttacacaacatatccgtagatggaactcaa
aaggatattatgaagtatatatatgaggcatcaaaaaattcaatgaaaaacaataaaata
ccaattatgctgggaggagagcattctataacttacccagtagtaaaatcggcaaaaaaa
aaatatgatgatatattattaattcaatttgatgcccactgcgatttaagggagaattat
ttgaataataaatattctcatgcaagtgtgataagaaggtgctttgatttaacaaaagat
atatatcaatttggaataagaagtggagatgaagaggaatgggaattcggagaaaaaaac
acaaatattagtatggagctcccaacaaaagaagacataaatataataaaagaattagat
aaaaaaatatatataacaatagatatagatgttttagaccctgcctttgccccgggaact
ggaacaccagagccatgcggattttcttcaaaagaattaatgaattcattatatttattt
aaagaattaaaagacaatatcataggttttgatgttgttgaggtttcaccgcattatgat
gctggaaatattacttcaattatgggggcaaaaatagtgagagaattaattttattataa

DBGET integrated database retrieval system