KEGG   Mycobacterium africanum: MAF_06840Help
Entry
MAF_06840         CDS       T01575                                 

Gene name
echA5
Definition
enoyl-CoA hydratase (EC:4.2.1.17)
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
maf  Mycobacterium africanum
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:maf00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    MAF_06840 (echA5)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MAF_06840 (echA5)
   00650 Butanoate metabolism
    MAF_06840 (echA5)
  Lipid metabolism
   00071 Fatty acid degradation
    MAF_06840 (echA5)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MAF_06840 (echA5)
   00310 Lysine degradation
    MAF_06840 (echA5)
   00360 Phenylalanine metabolism
    MAF_06840 (echA5)
   00380 Tryptophan metabolism
    MAF_06840 (echA5)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MAF_06840 (echA5)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MAF_06840 (echA5)
   00281 Geraniol degradation
    MAF_06840 (echA5)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MAF_06840 (echA5)
   00627 Aminobenzoate degradation
    MAF_06840 (echA5)
   00930 Caprolactam degradation
    MAF_06840 (echA5)
Enzymes [BR:maf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MAF_06840 (echA5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
772172..772963
Genome map
AA seq 263 aa AA seqDB search
MSDLVRVERKGRVTTVILNRPASRNAVNGPTAAALCAAFEQFDRDDAASVAVLWGAGGTF
CAGADLKAFGTPEANSVHRTGPGPMGPSRMMLSKPVIAAVSGYAVAGGLELALWCDLRVA
EEDAVFGVFCRRWGVPLIDGGTVRLPRLIGHSRAMDMILTGRGVPADEALAMGLANRVVP
KGQARQAAEELAAQLAALPQQCLRSDRLSALHQWGLPESAALDLEFASIARVAGEALEGA
RRFAAGAGRHGAPAPRAEQGDTL
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatctggtgcgtgtggagcgcaaaggtcgggtgaccacggtgattctgaaccgg
ccggcctcccgcaacgcggtcaacggcccgaccgccgcggcgttgtgcgcggcgttcgag
caattcgaccgggacgacgccgcgtcggtggccgtactctggggtgcgggtggaaccttt
tgtgcgggagccgatttgaaggcctttggcacaccggaggccaactctgtgcaccggacg
ggtcccggcccgatggggccgtcacgaatgatgctgtccaaacctgtgatcgccgccgtc
agcggctacgccgtcgccggggggctggaattggcactgtggtgcgacctgcgggtggcc
gaggaagacgccgtgttcggtgtgttttgccgtcgctggggggtaccgctcatcgacggc
ggcaccgtgcgactgccacggctgatcgggcacagccgcgcgatggacatgatcctcact
ggccgtggggtgccggccgacgaagcgctggccatggggttggccaatcgggtggtgccc
aagggtcaagcccgacaggcggctgaggagttggcggcgcaattggccgcgctgccgcag
cagtgtctgcgatcggatcggctgtcggcgctgcaccagtggggcctgcccgagtccgcg
gcgctcgacctcgagttcgccagcatcgcgcgggtggccggcgaggcgctagagggggcg
agacggttcgccgcgggtgccggtcggcatggggccccggcacctcgggccgaacagggc
gacacgctttag

DBGET integrated database retrieval system