KEGG   Mycobacterium africanum: MAF_09140Help
Entry
MAF_09140         CDS       T01575                                 

Gene name
echA6
Definition
enoyl-CoA hydratase (EC:4.2.1.17)
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
maf  Mycobacterium africanum
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:maf00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    MAF_09140 (echA6)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MAF_09140 (echA6)
   00650 Butanoate metabolism
    MAF_09140 (echA6)
  Lipid metabolism
   00071 Fatty acid degradation
    MAF_09140 (echA6)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MAF_09140 (echA6)
   00310 Lysine degradation
    MAF_09140 (echA6)
   00360 Phenylalanine metabolism
    MAF_09140 (echA6)
   00380 Tryptophan metabolism
    MAF_09140 (echA6)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MAF_09140 (echA6)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MAF_09140 (echA6)
   00281 Geraniol degradation
    MAF_09140 (echA6)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MAF_09140 (echA6)
   00627 Aminobenzoate degradation
    MAF_09140 (echA6)
   00930 Caprolactam degradation
    MAF_09140 (echA6)
Enzymes [BR:maf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MAF_09140 (echA6)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1004564..1005295
Genome map
AA seq 243 aa AA seqDB search
MIGITQAEAVLTIELQRPERRNALNSQLVEELTQAIRKAGDGSARAIVLTGQGTAFCAGA
DLSGDAFAADYPDRLIELHKAMDASPMPVVGAINGPAIGAGLQLAMQCDLRVVAPDAFFQ
FPTSKYGLALDNWSIRRLSSLVGHGRARAMLLSAEKLTAEIALHTGMANRIGTLADAQAW
AAEIARLAPLAIQHAKRVLNDDGAIEEAWPAHKELFDKAWGSQDVIEAQVARMEKRPPKF
QGA
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgatcggtatcacccaggcagaagccgtgctgaccattgagctgcaacgcccggagcgc
cgcaacgccttaaattcccagctggtcgaggagcttacgcaggccatccggaaagccggg
gatggatcggctcgggcgatcgtgctgaccggccaaggcaccgcgttctgcgctggcgcg
gacctgagcggagacgcattcgccgccgattatcccgaccggctcatcgagctgcacaag
gcgatggacgcctccccgatgccagtggtcggcgcgatcaacggtcccgccatcggcgcc
ggcttgcagcttgccatgcaatgcgacctgcgggttgtcgcgcccgatgccttcttccag
tttccgacgtcgaaatacggtctggccctggataactggagcatccgccggctgtcgtcg
ttggttgggcacggacgtgcccgcgcgatgctgctcagcgcggaaaagctgaccgccgag
atcgcactgcacaccggaatggcgaatcgcattggcactttggccgacgcccaggcctgg
gccgccgagatcgccaggctggcaccactggctatccagcacgccaagcgggtgctcaac
gacgacggcgctatcgaggaagcgtggccggcccataaggaactcttcgacaaagcctgg
ggcagccaggatgtcatcgaagcgcaggttgcccggatggaaaagcggccgccgaagttc
caaggggcttaa

DBGET integrated database retrieval system