KEGG   Mycobacterium africanum: MAF_13500Help
Entry
MAF_13500         CDS       T01575                                 

Gene name
glgB
Definition
(GenBank) putative 1,4-alpha-glucan branching enzyme GLGB (glycogen branching enzyme)
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
maf  Mycobacterium africanum
Pathway
maf00500  Starch and sucrose metabolism
maf01100  Metabolic pathways
maf01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:maf00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MAF_13500 (glgB)
Enzymes [BR:maf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     MAF_13500 (glgB)
Exosome [BR:maf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MAF_13500 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_48 Alpha-amylase_C Alpha-amylase Glyco_hydro_70
Motif
Other DBs
NCBI-ProteinID: CCC26422
UniProt: F8M6R0
Position
complement(1494757..1496952)
Genome map
AA seq 731 aa AA seqDB search
MSRSEKLTGEHLAPEPAEMARLVAGTHHNPHGILGAHEYGDHTVIRAFRPHAVEVVALVG
KDRFSLQHLDSGLFAVALPFVDLIDYRLQVTYEGCEPHTVADAYRFLPTLGEVDLHLFAE
GRHERLWEVLGAHPRSFTTADGVVSGVSFAVWAPNAKGVSLIGEFNGWNGHEAPMRVLGP
SGVWELFWPDFPCDGLYKFRVHGADGVVTDRADPFAFGTEVPPQTASRVTSSDYTWGDDD
WMAGRALRNPVNEAMSTYEVHLGSWRPGLSYRQLARELTDYIVDQGFTHVELLPVAEHPF
AGSWGYQVTSYYAPTSRFGTPDDFRALVDALHQAGIGVIVDWVPAHFPKDAWALGRFDGT
PLYEHSDPKRGEQLDWGTYVFDFGRPEVRNFLVANALYWLQEFHIDGLRVDAVASMLYLD
YSRPEGGWTPNVHGGRENLEAVQFLQEMNATAHKVAPGIVTIAEESTSWPGVTRPTNIGG
LGFSMKWNMGWMHDTLDYVSRDPVYRSYHHHEMTFSMLYAFSENYVLPLSHDEVVHGKGT
LWGRMPGNNHVKAAGLRSLLAYQWAHPGKQLLFMGQEFGQRAEWSEQRGLDWFQLDENGF
SNGIQRLVRDINDIYRCHPALWSLDTTPEGYSWIDANDSANNVLSFMRYGSDGSVLACVF
NFAGAEHRDYRLGLPRAGRWREVLNTDATIYHGSGIGNLGGVDATDDPWHGRPASAVLVL
PPTSTLWLTPA
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgatccgagaaactcaccggggagcaccttgcacccgagccggccgaaatggcg
cgcttggtggcgggtacacatcacaacccgcacggcatcctgggcgcccacgaatacggc
gaccataccgtcatccgagcgttccgtccgcatgccgtcgaggtcgtcgcgctcgttggt
aaggaccggttctcgttgcagcacctcgattctggcctgtttgccgtcgcattgccgttc
gtcgacctcatcgactaccgcctgcaggtgacctatgaaggttgcgagccacacaccgtg
gccgatgcgtaccgattcctgcccaccctgggcgaggtcgacctgcacctgttcgccgag
ggccgccacgaacggctttgggaagtcctgggtgcccacccccgctcgtttaccacggcc
gacggtgtggtgagtggcgtgtcgttcgccgtgtgggcgcccaacgccaagggcgtcagc
ttgatcggcgagttcaacggttggaatggccacgaagcccccatgcgggtgctcggccca
tcaggggtatgggaattgttctggcccgacttcccttgcgacggtctgtacaagttccgc
gtgcacggcgccgacggcgtggttaccgatcgggccgacccgttcgcgttcggcaccgag
gtgccgccgcagaccgcatcgcgggtgacgtcgagtgactacacctggggtgacgacgac
tggatggctgggcgtgcgctgcgcaacccggtgaacgaggcgatgagcacctacgaagtc
catctcggttcgtggcggcctggactcagctaccgccagcttgctcgtgagttgacggat
tacattgtggatcaagggtttacccatgtggagctgttgcccgtcgccgagcatccattc
gccggatcatgggggtatcaggtcacgtcctactatgcgccgacatcacgattcggcaca
cccgacgacttccgggcgctggtcgacgccctgcaccaggccggcatcggcgtcatcgtg
gattgggtcccagcgcacttcccgaaggacgcgtgggccctgggacggttcgacggcact
ccgctctacgaacattccgatcccaaacgcggcgagcaactggattggggcacatacgtg
ttcgacttcggccgcccggaagtgcgcaactttctggtagccaatgcgttgtactggcta
caggagttccacatcgacggcctgcgggtggacgcggtggcctcaatgctctatctagac
tactcgcgacccgagggcggctggacccccaacgtccacggcggccgggagaacctggaa
gcagtgcagttcctgcaggagatgaacgccacggcgcacaaggtcgcgccgggaatcgtc
accatcgccgaggagtccacgtcgtggcctggggtgacccgcccgaccaacattggcggc
ctgggcttttcgatgaagtggaacatgggctggatgcacgacacgctcgactacgtcagc
cgagatccggtgtaccgcagctaccaccaccacgagatgacgttctcgatgctgtatgcg
ttcagcgaaaattacgtgttgccgctcagtcatgacgaggtggtgcacggcaaaggcacg
ctgtgggggcggatgccgggcaacaatcacgtcaaggccgccggcctgcgtagcctgctt
gcctaccaatgggcacaccccggcaagcaattgctgttcatgggtcaggaattcggccaa
cgcgccgaatggtccgagcagcgcggcctggactggttccaactcgacgaaaacggcttc
tccaacgggattcagcggctggtgcgcgacatcaacgacatctaccgatgccacccggcg
ctgtggagcttagacaccacccccgaaggctattcttggatcgacgccaacgactccgcc
aacaatgtgttgagctttatgcgctacggcagcgacggctcggtgctggcctgcgtgttc
aatttcgcaggtgccgaacaccgtgactatcgactcgggctgccgcgcgcgggccgctgg
cgcgaggtgctcaataccgacgcgacgatctaccacggctcagggatcggcaacctcggc
ggcgtggacgccaccgacgacccctggcatggccgcccggcgtccgcggtgctggtgctg
ccgcccacttcgacgctgtggctgacgcccgcctag

DBGET integrated database retrieval system