KEGG   Mycobacterium africanum: MAF_17210Help
Entry
MAF_17210         CDS       T01575                                 

Definition
catechol-O-methyltransferase (EC:2.1.1.6)
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
maf  Mycobacterium africanum
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:maf00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    MAF_17210
Enzymes [BR:maf01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     MAF_17210
Exosome [BR:maf04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   MAF_17210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1921474..1922064)
Genome map
AA seq 196 aa AA seqDB search
MLATIDKFAYEKSMLINVGDEKGTLLDAAVRRADPALALELGTYLGYGALRIARAAPEAR
VYSVELAEANASNARRIWAHAGVDDRVVCVVGTIGDGGRTLDALTEHGFATGTLDFVFLD
HDKKAYLPDLQSILDRGWLHPGSIVVADNVRVPGAPKYRAYMRRQQGMSWNTIEHKTHLE
YQTLVPDLVLESEYLG
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
gtgctggccaccatcgacaagttcgcctatgagaagtcgatgctcatcaacgtcggtgac
gagaaagggacgctgctcgacgcggcggttcggcgcgccgacccggcattggcgctggag
ttgggcacctacctcggctacggcgcgctgcggatcgcccgggccgctccggaggccagg
gtgtactccgtcgaactcgccgaagccaacgccagcaacgcccggcgaatatgggcgcat
gccggcgtcgatgacagggtggtgtgcgtggtcggcaccatcggcgacggtgggcgcacc
ctggacgcgctaaccgagcacggattcgcaactggcacactcgattttgtgttcctcgac
catgacaagaaggcttacctgcccgatctgcagagcatcctagaccggggctggttgcac
ccgggctcgatcgtggttgccgacaatgtcagggtgcccggcgcgccgaagtaccgtgca
tatatgcgccggcaacaaggcatgtcatggaacaccattgagcacaagacgcacctcgaa
taccagaccctggtgcccgacttggtattggagtccgaatacctgggttag

DBGET integrated database retrieval system