KEGG   Mycobacterium africanum: MAF_20600Help
Entry
MAF_20600         CDS       T01575                                 

Gene name
lipT
Definition
carboxylesterase (EC:3.1.1.-)
Orthology
K03929  
para-nitrobenzyl esterase [EC:3.1.1.-]
Organism
maf  Mycobacterium africanum
Brite
Enzymes [BR:maf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.-  
     MAF_20600 (lipT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2282493..2284028)
Genome map
AA seq 511 aa AA seqDB search
MALESATVGSMHERTVRARTATGIVEGFTRDGVHRWRSIPYARAPVGSLRFRAPQPAQPW
PGVRHCHTFANCAPQQRRYTVMGIGRYQTRSEDCLTLNVVTPEEPATQPLPVMVFIHGGG
YILGSSATPIYDGAALARRGCVYVSVNYRLGALGCLDLSSLSTPQITLDSNVYLRDLVLA
LRWVHDNIAEFGGDPGNVTIFGESAGAHITATLLAVPAAKGLFARAISESPAAGMVRSRE
VAAEFAARFANLIGARTQDAANALMQASPAQLVEAQHHLIRQGMRKRLGAFPIGPVFGDD
YLPMDPVEAMRSGRVHAVPLIVGTNAEEGRLFTRFLGMLPTNEPMVEELLSGMKPADRER
ITAAYPNYPAPSACIQLGGDFAFSSAAWQIAEAHGANAPTYLYRYDYAPRTLRWSGFGAT
HATELFAVFDIYRTRFGALLTAAADRRAALRVSNEVQRRWRCFSQIGVPGDDWPAYTQDD
RAVLVFDRRCRIEFDPHQHRRIAWDGFSLAN
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
gtggccctggagtcggctaccgtcgggtctatgcacgagcgcaccgtgcgcgcccgcacg
gccaccggcatcgttgaaggcttcacgcgcgacggtgtgcaccgttggcgatcaatccct
tacgccagggcgccggtgggctcgctgcgattccgggcgccgcagccagcgcagccctgg
ccgggcgtacggcactgccacacgtttgccaactgtgctcctcagcagcgccgctacacc
gtgatgggcatcggcaggtaccagacccgcagcgaggactgtctcaccctcaacgtcgtc
acacccgaagagccagccacccagccgctgccggtaatggtgttcatccacggtgggggc
tacatcctgggcagctcggcaaccccgatatacgacggcgcagcgttggcacgccgcggc
tgcgtgtacgtgtcggtcaactaccggctgggcgcgttggggtgtcttgacctgtcgtcc
ttgtcgacaccgcagatcaccctcgacagcaacgtgtacctgcgcgacctggtgttggcg
ttgcgttgggtccacgacaacatcgcggagttcggcggtgacccaggcaatgtcaccatt
ttcggcgaaagcgcgggcgcgcatatcaccgccacactgttggcggtgccagccgccaaa
ggcctattcgccagggcgatctcggaaagcccagcggcgggcatggtgcgttcgcgcgag
gtggccgccgagttcgcggcacgctttgccaatctgatcggcgcgcgtacccaggatgcc
gccaatgcgttgatgcaggcgtcccccgcgcagctggtggaagcccaacaccacctgatt
cgccagggaatgcggaaaaggctgggcgccttcccgattggtccggtgttcggcgacgac
tacctgcccatggaccccgtcgaggcgatgcggtccggccgggtgcacgcggttccgctg
atcgtgggaaccaacgccgaagagggtcggttgttcacccgctttctggggatgctgccg
accaacgaaccgatggttgaagagctactgtcgggcatgaaaccggccgatcgtgaacgc
attaccgccgcctacccgaattaccctgcgccctcggcgtgcatccagctcggtggtgac
ttcgcctttagctcggcggcctggcagatcgccgaggctcacggcgccaatgcgcccacc
tacctataccgatatgactacgcgccacggacgctgcgctggtcgggtttcggcgccacc
catgccaccgaactgtttgccgtcttcgacatctatcgcaccagatttggcgcattgctg
accgccgccgccgaccgccgtgccgcccttcgggtcagcaacgaggtgcaacgccgctgg
cgttgtttcagccaaattggtgttccgggcgacgactggccggcttacacccaagacgac
cgtgccgtcctggttttcgaccgcaggtgccgcatcgagttcgatccgcatcagcaccgc
cggatcgcatgggacgggttttcgctggcgaattga

DBGET integrated database retrieval system