KEGG   Mycobacterium africanum: MAF_21430Help
Entry
MAF_21430         CDS       T01575                                 

Gene name
cysQ
Definition
monophosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
maf  Mycobacterium africanum
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:maf00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2381755..2382558)
Genome map
AA seq 267 aa AA seqDB search
MVSPAAPDLTDDLTDAELAADLAADAGKLLLQVRAEIGFDQPWTLGEAGDRQANSLLLRR
LQAERPGDAVLSEEAHDDLARLKSDRVWIIDPLDGTREFSTPGRDDWAVHIALWRRSSNG
QPEITDAAVALPARGNVVYRTDTVTSGAAPAGVPGTLRIAVSATRPPAVLHRIRQTLAIQ
PVSIGSAGAKAMAVIDGYVDAYLHAGGQWEWDSAAPAGVMLAAGMHASRLDGSPLRYNQL
DPYLPDLLMCRAEVAPILLGAIADAWR
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
gtggtgagccctgccgcacctgatctgacggacgacctgactgacgccgagctggccgcc
gacctggcggcggacgcgggaaagctgttgctccaggtgcgtgcggagatcggtttcgat
cagccatggacgctcggggaagccggtgaccgccaggctaactcgctgctgttgcgacgg
ctgcaggccgaacggccgggtgacgcagtgctcagtgaggaggcccacgacgatctggcc
cggctgaaatccgatcgggtgtggattattgacccgttggatggcacccgcgagttctcc
acaccgggtcgcgacgactgggcggtacacattgcgctgtggcggcgttcctccaatggc
cagcccgagatcaccgacgccgcggtggcgttgccggcccgtggcaacgtggtgtaccgc
accgatacggtgacttccggcgccgcgccggccggcgttcctggcaccttgcggattgcc
gtcagcgccacccggccaccggcagtcctgcaccgcatccgccagacgctggcgatccaa
ccggtgtcgatcggttcggcgggcgccaaagcgatggccgtcattgacggctacgtcgac
gcctacctgcacgccggaggccaatgggagtgggattccgcggcgccggctggggtgatg
ttggccgccggcatgcacgcgtcacgactcgatggctcgccgctgcgatacaaccaactg
gacccctacctgccggatctgctgatgtgtcgagccgaggtggcgccgatcctgctcggt
gccatcgccgacgcgtggcgctga

DBGET integrated database retrieval system