KEGG   Mycobacterium africanum: MAF_25010Help
Entry
MAF_25010         CDS       T01575                                 

Gene name
echA14
Definition
enoyl-CoA hydratase (EC:4.2.1.17)
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
maf  Mycobacterium africanum
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:maf00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    MAF_25010 (echA14)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MAF_25010 (echA14)
   00650 Butanoate metabolism
    MAF_25010 (echA14)
  Lipid metabolism
   00071 Fatty acid degradation
    MAF_25010 (echA14)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MAF_25010 (echA14)
   00310 Lysine degradation
    MAF_25010 (echA14)
   00360 Phenylalanine metabolism
    MAF_25010 (echA14)
   00380 Tryptophan metabolism
    MAF_25010 (echA14)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MAF_25010 (echA14)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MAF_25010 (echA14)
   00281 Geraniol degradation
    MAF_25010 (echA14)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MAF_25010 (echA14)
   00627 Aminobenzoate degradation
    MAF_25010 (echA14)
   00930 Caprolactam degradation
    MAF_25010 (echA14)
Enzymes [BR:maf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MAF_25010 (echA14)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2781147..2781917
Genome map
AA seq 256 aa AA seqDB search
MAQYDPVLLSVDKHVALITVNDPDRRNAVTDEMSAQLRAAIQRAEGDPDVHAVVVTGAGK
AFCAGADLSALGAGVGDPAEPRLLRLYDGFMAVSSCNLPTIAAVNGAAVGAGLNLALAAD
VRIAGPAALFDARFQKLGLHPGGGATWMLQRAVGPQVARAALLFGMCFDAESAVRHGLAL
MVADDPVTAALELAAGPAAAPREVVLASKATMRATASPGSLDLEQHELAKRLELGPQAKS
VQSPEFAARLAAAQHR
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggcccaatacgacccggtcttgctcagcgtcgacaagcacgttgcgctcatcacggtc
aacgacccggaccgacggaacgccgtcaccgacgagatgtcggcgcagttgcgtgcggcg
atccaacgcgccgaaggcgaccccgacgtacacgccgtagtcgtgaccggggcgggcaag
gccttctgcgccggggccgacctgagtgcgctgggcgccggggtcggcgatccagccgag
ccgagattgttacggctctacgacggtttcatggccgtcagtagttgtaatctgcccacc
atcgccgcggtcaacggcgcggctgtgggcgccggactcaatctggcgttggccgccgat
gtgcgcatcgccggaccggccgcattgttcgacgcccgcttccaaaagctgggactgcat
ccaggtggcggcgcaacctggatgctgcagcgagcggtgggtccgcaggtcgcccgtgcg
gccttattgttcggcatgtgcttcgacgccgaatccgctgtgcggcacggcttggcgcta
atggttgccgacgatcccgtcaccgcggcgctggagctggccgccgggcccgcagccgcc
ccgcgcgaggtcgtgctggcgagcaaagccaccatgcgcgccacagccagccccggatcg
ctggaccttgagcaacacgaactcgccaaacgcttagaacttgggccgcaggcgaaatcg
gtccagtcgcccgagttcgccgctcgcttggctgccgctcaacacaggtag

DBGET integrated database retrieval system