KEGG   Mycobacterium africanum: MAF_26100Help
Entry
MAF_26100         CDS       T01575                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RUVA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
maf  Mycobacterium africanum
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:maf03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2911667..2912257)
Genome map
AA seq 196 aa AA seqDB search
MIASVRGEVLEVALDHVVIEAAGVGYRVNATPATLATLRQGTEARLITAMIVREDSMTLY
GFPDGETRDLFLTLLSVSGVGPRLAMAALAVHDAPALRQVLADGNVAALTRVPGIGKRGA
ERMVLELRDKVGVAATGGALSTNGHAVRSPVVEALVGLGFAAKQAEEATDTVLAANHDAT
TSSALRSALSLLGKAR
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcctcggtccgcggtgaggtgctcgaggtggcgcttgaccatgtggtgatcgag
gccgccggtgtgggctaccgagtgaacgcgacaccggcgacgctggcgacgttgcggcaa
ggcaccgaggcccggctgatcaccgcgatgattgtgcgcgaggactcgatgacgctgtac
gggtttcccgacggggaaacccgcgacctattcctgacgctgctgtcggtctccggcgtt
gggccccggctggcgatggcggcactggccgtgcacgacgctccggcgctacggcaggtg
ctggccgacggcaacgtcgccgccctgacccgggtgcctgggatcggcaagcggggcgcc
gaacgcatggtgttggaactacgcgacaaggttggggtggcagccaccggcggcgcactc
tcgaccaacggccacgcggtgcgcagtcccgtggtcgaggctctggtcggcctgggcttt
gcggccaaacaggccgaggaggccaccgatacggtgctggccgccaaccatgacgcgacg
acatccagcgcgctgcggtctgccttgtcgttgctggggaaggcccgatga

DBGET integrated database retrieval system