KEGG   Mycobacterium africanum: MAF_27450Help
Entry
MAF_27450         CDS       T01575                                 

Definition
hypothetical protein
Orthology
K10533  
limonene-1,2-epoxide hydrolase [EC:3.3.2.8]
Organism
maf  Mycobacterium africanum
Pathway
Limonene and pinene degradation
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Limonene and pinene degradation [PATH:maf00903]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3029802..3030251
Genome map
AA seq 149 aa AA seqDB search
MAELTETSPETPETTEAIRAVEAFLNALQNEDFDTVDAALGDDLVYENVGFSRIRGGRRT
ATLLRRMQGRVGFEVKIHRIGADGAAVLTERTDALIIGPLRVQFWVCGVFEVDDGRITLW
RDYFDVYDMFKGLLRGLVALVVPSLKATL
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atggccgagctgaccgaaacatcgccggaaacccccgaaaccaccgaggccattcgtgcc
gtcgaggcgttcctcaacgccctgcagaacgaagacttcgacaccgtcgacgccgcactg
ggcgacgacctggtctatgagaacgtcgggttttccaggatccgcggtggccgccgcacg
gcaacgctgcttcgccgcatgcagggccgcgtcggcttcgaggtgaagatccaccgcatc
ggcgccgacggcgccgcggtgctcaccgaacgcaccgacgcgctaatcatcggaccgctg
cgggtgcagttctgggtctgcggcgtattcgaggtggacgatgggcggatcaccctgtgg
cgggactacttcgatgtctacgacatgttcaagggcctcttgcgaggcctggtggcgctg
gtggtgccatcgctgaaggcaacgctgtag

DBGET integrated database retrieval system