KEGG   Mycobacterium africanum: MAF_29720Help
Entry
MAF_29720         CDS       T01575                                 

Gene name
pca
Definition
(GenBank) putative pyruvate carboxylase PCA (pyruvic carboxylase)
  KO
K01958  
pyruvate carboxylase [EC:6.4.1.1]
Organism
maf  Mycobacterium africanum
Pathway
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:maf00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MAF_29720 (pca)
   00620 Pyruvate metabolism
    MAF_29720 (pca)
Enzymes [BR:maf01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     MAF_29720 (pca)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3298309..3301692)
Genome map
AA seq 1127 aa AA seqDB search
MFSKVLVANRGEIAIRAFRAAYELGVGTVAVYPYEDRNSQHRLKADESYQIGDIGHPVHA
YLSVDEIVATARRAGADAIYPGYGFLSENPDLAAACAAAGISFVGPSAEVLELAGNKSRA
IAAAREAGLPVLMSSAPSASVDELLSVAAGMPFPLFVKAVAGGGGRGMRRVGDIAALPEA
IEAASREAESAFGDPTVYLEQAVINPRHIEVQILADNLGDVIHLYERDCSVQRRHQKVIE
LAPAPHLDAELRYKMCVDAVAFARHIGYSCAGTVEFLLDERGEYVFIEMNPRVQVEHTVT
EEITDVDLVASQLRIAAGETLEQLGLRQEDIAPHGAALQCRITTEDPANGFRPDTGRISA
LRTAGGAGVRLDGSTNLGAEISPYFDSMLVKLTCRGRDLPTAVSRARRAIAEFRIRGVST
NIPFLQAVLDDPDFRAGRVTTSFIDERPQLLTARASADRGTKILNFLADVTVNNPYGSRP
STIYPDDKLPDLDLRAAPPAGSKQRLVKLGPEGFARWLRESAAVGVTDTTFRDAHQSLLA
TRVRTSGLSRVAPYLARTMPQLLSVECWGGATYDVALRFLKEDPWERLATLRAAMPNICL
QMLLRGRNTVGYTPYPEIVTSAFVQEATATGIDIFRIFDALNNIESMRPAIDAVRETGSA
IAEVAMCYTGDLTDPGEQLYTLDYYLKLAEQIVDAGAHVLAIKDMAGLLRPPAAQRLVSA
LRSRFDLPVHLHTHDTPGGQLASYVAAWHAGADAVDGAAAPLAGTTSQPALSSIVAAAAH
TEYDTGLSLSAVCALEPYWEALRKVYAPFESGLPGPTGRVYHHEIPGGQLSNLRQQAIAL
GLGDRFEEIEEAYAGADRVLGRLVKVTPTSKVVGDLALALVGAGVSADEFASDPARFGIP
ESVLGFLRGELGDPPGGWPEPLRTAALAGRGAARPTAQLAADDEIALSSVGAKRQATLNR
LLFPSPTKEFNEHREAYGDTSQLSANQFFYGLRQGEEHRVKLERGVELLIGLEAISEPDE
RGMRTVMCILNGQLRPVLVRDRSIASAVPAAEKADRGNPGHIAAPFAGVVTVGVCVGERV
GAGQTIATIEAMKMEAPITAPVAGTVERVAVSDTAQVEGGDLLVVVS
NT seq 3384 nt NT seq  +upstreamnt  +downstreamnt
gtgttttccaaggtgctcgtcgccaatcgcggggagatcgcgatccgggcctttcgtgcc
gcctacgaactgggcgtcggaaccgtggccgtttatccgtacgaggaccgcaattcgcag
caccgtctcaaggcggacgagtcttaccagatcggcgacatcggtcacccggtgcatgca
tacctgtcggtcgacgagatcgtcgcgacggcccgtcgggcgggtgccgacgctatctac
cctggctacgggtttctatcggagaatccggatctggctgcggcatgcgcggcggcgggc
atcagcttcgtcggtcccagcgccgaagtgcttgagctggctgggaataagtctcgcgcc
atcgcggcggcccgcgaagccggcttgcccgtgctgatgtcctcggcgccgtcggcctcg
gtcgacgaactgctgtcggttgcggccggcatgccgtttccgttgttcgtcaaggcagtt
gccggtggcgggggccggggtatgcgtcgtgtcggcgatatcgcggcgcttccggaggcg
atcgaagccgccagccgggaagccgagtcggcgttcggggacccgacggtctatctcgag
caggcagtgatcaatccacgccacatcgaggtgcagattctggcggacaacctcggcgac
gtgatccatctctatgagcgtgactgcagtgtgcagcgtcgccatcagaaggtcatcgag
ctggcgcccgcgccgcacctggacgccgagttgcgttacaagatgtgcgtcgatgcggtc
gccttcgcccgccatatcgggtacagctgcgcgggcaccgtcgagttcctgctggacgag
cgaggggagtatgtcttcatcgagatgaatccgcgggttcaggtggagcacacggtgacc
gaggagattaccgacgtcgacctggtcgccagccagctgcgcattgccgccggggagacg
ctcgaacaattgggcctgcggcaggaggacatcgcaccgcatggcgccgcactacagtgc
cggatcaccaccgaggatccggccaacggcttccggccggacacgggccggatcagcgcg
ttgcgcaccgccggcggtgccggtgtccgcctggacggcagcaccaacctgggcgcagaa
atcagcccgtacttcgactccatgctggtcaagctgacctgtcggggccgtgacctccct
accgcagtgagccgtgcgcgccgggcgatcgcggagttccggatccgcggggtatcgacg
aatattccgttcctgcaagcggtcctggatgacccggacttccgagcgggccgggtcacc
acgtccttcattgatgagcggccgcagctgctgaccgcgcgcgcctcggccgaccgcggc
accaagatccttaacttcctggccgatgtcaccgtcaacaacccgtatggctcgcgtccg
tcaacgatctacccggacgacaagctgcccgatcttgatctgcgggccgcaccaccggcc
gggtccaagcagcgactagtcaagttggggccggaaggatttgctcgttggctgcgggag
tcggccgcggtcggggtcaccgataccacattccgggatgctcaccagtcgttactggct
acccgagtacgcaccagcggactgtcgcgggtggcaccgtatctcgcgcggaccatgccg
cagctgttgtccgtggagtgttggggcggtgcgacttacgatgtggcgctgcgctttctc
aaggaggatccctgggaacggctggccacactgcgtgcagcaatgcccaatatctgcttg
cagatgctattgcggggccgcaataccgtgggctacacgccgtacccggaaatcgtgacg
tcggcgtttgtgcaagaagcaacagccaccggtatcgacatctttcgtatcttcgacgcg
ctcaacaacatcgagtcgatgcgtccggcgatcgacgcagtacgcgaaacaggttctgcg
atagcagaagtcgcgatgtgctacacgggcgaccttaccgatccgggtgaacagctgtac
acgctggactactacctgaaactggctgagcagatcgtggacgccggcgcccatgtgctg
gcgatcaaggatatggctggactgttgcgcccgccggccgctcaaaggttggtcagcgcc
ctgcgcagtcgcttcgacctgcccgttcacctgcacacccacgacacaccgggtggccag
ctcgccagctatgtggccgcttggcacgccggggccgatgccgtcgacggcgccgccgcg
ccgctggcgggaacgaccagccagcccgcgctgagctcgatcgttgctgccgctgcccac
accgagtacgacaccggcctgtcgctttcggcggtgtgcgccctggagccgtactgggag
gcgttacgaaaagtgtatgcgccgttcgagtctgggttgccggggccgacggggcgggtt
tatcaccacgagattccgggcggccaactgtccaatctgcgccagcaagcaattgctctt
ggtctgggagatcgattcgaagagatcgaagaggcctacgcgggcgccgaccgagtgttg
ggcaggctggttaaggtcacgccaacgtccaaggtggtcggcgatctggcgctggcactg
gtcggcgccggtgtcagtgcagacgaattcgcctccgatccagcgcgatttggcatcccg
gaatcggtactcggatttctgcggggcgagctgggtgatccgcccggcgggtggcccgaa
ccgctgcgcactgcggcgctggccggtcgcggggcggccaggcccactgcgcaattggcg
gcggacgacgagattgccctatcgtcggtcggagccaagcgtcaggccaccctgaacagg
ctgttatttcccagtccaacaaaggaattcaatgagcaccgggaagcctacggcgacacg
tcgcaattgtcggccaaccagttcttctatggtctgcgccaaggtgaagagcatcgggtg
aagctggagcgtggggtggagctgttgatcgggctggaggccatttccgaacccgacgaa
cgcggcatgcgaacggtgatgtgcatcctcaacgggcagctgcggccggtgctagtgcgc
gaccgcagcattgccagtgccgttccggccgccgagaaggccgaccgcggcaatcccgga
cacatcgccgcgccatttgccggagtcgtcacggtcggggtgtgcgtcggcgagcgggtc
ggcgccggccaaaccatcgccaccatcgaggcgatgaagatggaagccccgatcaccgcc
ccggttgccggcaccgtggagcgggtggcggtgtcggacaccgcccaggtggagggcgga
gacctgttggtggtggtgagctga

DBGET integrated database retrieval system