KEGG   Mycobacterium africanum: MAF_29770Help
Entry
MAF_29770         CDS       T01575                                 

Definition
(GenBank) putative oxidoreductase
Organism
maf  Mycobacterium africanum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3304747..3305595
Genome map
AA seq 282 aa AA seqDB search
MTGESGAAAAPSITLNDEHTMPVLGLGVAELSDDETERAVSAALEIGCRLIDTAYAYGNE
AAVGRAIAASGVAREELFVTTKLATPDQGFTRSQEACRASLDRLGLDYVDLYLIHWPAPP
VGKYVDAWGGMIQSRGEGHARSIGVSNFTAEHIENLIDLTFVTPAVNQIELHPLLNQDEL
RKANAQHTVVTQSYCPLALGRLLDNPTVTSIASEYVKTPAQVLLRWNLQLGNAVVVRSAR
PERIASNFDVFDFELAAEHMDALGGLNDGTRVREDPLTYAGT
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
gtgactggcgagtcgggcgccgccgccgcaccctcgattaccctcaacgacgagcatacg
atgccggtgcttggcctcggcgtcgcggaattgtcggacgacgagaccgaacgtgcggtg
tccgcggcgctggaaattggctgccggctgatcgacaccgcctacgcctatggcaacgag
gccgcggtcggccgcgcaattgcagcctccggcgttgcccgcgaagagctgttcgtcacc
accaagctagccacccccgaccagggtttcacccgttcccaggaagcatgtagagccagt
ttggaccgcctcggcctcgactacgtcgacctttacctaattcactggccggccccgccg
gtgggcaagtatgtggacgcctggggaggcatgattcaatcccgcggagagggccatgcc
cgatcgatcggcgtgtccaacttcaccgcggagcacatcgaaaaccttatcgacctcaca
ttcgtcacgccggcggtcaaccagatcgagctgcacccgctgctcaaccaggacgaactg
cgcaaagctaacgcccagcacaccgtcgtcacacagtcctactgccccctggcactcggc
aggctgctggacaacccaaccgtcacatcaatcgccagcgaatacgtcaagacgcccgca
caagtgctgctgcggtggaacctgcaattgggcaatgcggtggtcgtccgctcggccaga
cccgagcgcatcgccagcaacttcgacgtcttcgacttcgagttggcggccgaacacatg
gatgcattgggcgggctcaatgacggcacccgggtgcgcgaggatccactgacctacgcc
ggcacctga

DBGET integrated database retrieval system