KEGG   Mycobacterium africanum: MAF_29780Help
Entry
MAF_29780         CDS       T01575                                 

Definition
(GenBank) putative conserved membrane or exported protein
Organism
maf  Mycobacterium africanum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3305669..3306382)
Genome map
AA seq 237 aa AA seqDB search
MNRRTLLWLSAIAALALVVAYQTLGSSAGRHADEFAARAGVPTVQPGADVLAGIAVLPKR
IHRYDYRRSAFGHPWDDRNDAPGGHNGCDTRDDILDRDLVDKTYVSIKRCPNAVATGTLR
DPYTNTTVAFQRGASVGQSVQIDHIVPLSYAWDMGAYRWPNSERMRFANDPANLLAVQGQ
ANQDKGDSPPAQWMPPNKAFACQYAMQFIAVLRGYSLPVDQPSSDVLRQAAATCPTG
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgcagaacgctactgtggctgtcggcgatcgcggcgctggcgctggtggtcgcg
tatcagacgctgggatcatcggcgggcaggcacgctgacgagttcgccgcccgcgctggc
gtgccaaccgtgcaacccggtgccgacgtgctcgccggcatcgccgtgctacccaaacgg
atccaccgctacgactaccgcaggtccgcattcggtcacccctgggacgatcgcaatgac
gcgccgggagggcacaacgggtgcgacacccgcgacgacatcctcgaccgggatctggtc
gacaagacatatgtgtcgatcaagcggtgtccgaatgcggtggccaccggcaccctgcgc
gatccgtacaccaacaccaccgttgccttccaacgcggcgccagtgttggccaatcggtc
cagatcgaccacatcgttccgctctcgtatgcctgggacatgggcgcctatcggtggccg
aactccgagcgaatgcgcttcgccaacgatccggccaacctgctggccgtgcaggggcag
gcaaatcaggacaagggcgattcgccaccggcccaatggatgccacccaacaaggccttc
gcctgtcagtacgcgatgcaattcatcgccgtgctgcgcggctattcactgccagtggat
cagccatcgtccgacgtactgcgtcaggccgcggccacctgcccgacgggctag

DBGET integrated database retrieval system