KEGG   Mycobacterium africanum: MAF_29820Help
Entry
MAF_29820         CDS       T01575                                 

Gene name
thiL
Definition
(GenBank) putative thiamine-monophosphate kinase THIL (thiamine-phosphate kinase)
  KO
K00946  
thiamine-monophosphate kinase [EC:2.7.4.16]
Organism
maf  Mycobacterium africanum
Pathway
Thiamine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:maf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    MAF_29820 (thiL)
Enzymes [BR:maf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.16  thiamine-phosphate kinase
     MAF_29820 (thiL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3311431..3312432)
Genome map
AA seq 333 aa AA seqDB search
MTTKDHSLATESPTLQQLGEFAVIDRLVRGRRQPATVLLGPGDDAALVSAGDGRTVVSTD
MLVQDSHFRLDWSTPQDVGRKAIAQNAADIEAMGARATAFVVGFGAPAETPAAQASALVD
GMWEEAGRIGAGIVGGDLVSCRQWVVSVTAIGDLDGRAPVLRSGAKAGSVLAVVGELGRS
AAGYALWCNGIEDFAELRRRHLVPQPPYGHGAAAAAVGAQAMIDVSDGLLADLRHIAEAS
GVRIDLSAAALAADRDALTAAATALGTDPWPWVLSGGEDHALVACFVGPVPAGWRTIGRV
LDGPARVLVDGEEWTGYAGWQSFGEPDNQGSLG
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
gtgaccactaaagatcactcacttgcaacggagtccccgacgctgcagcagctcggcgag
ttcgccgtgatcgaccggctggtgcgggggcgccgacaacccgccacggtactgctcggg
cccggcgacgatgccgcgctggtgtctgccggcgatggtcgcactgtggtgtcgacggac
atgctggtgcaagatagtcacttccggctggactggtcgacaccgcaggacgtcggccgc
aaggcgatcgcccagaatgccgccgacatcgaggcgatgggggcgcgggccaccgcgttc
gtggtcggctttggagcacccgctgagacgccggcggcgcaggcgagcgcgttggtcgac
ggaatgtgggaggaggcggggcgcattggtgccggcatcgtcggcggcgatctggtcagc
tgccggcagtgggtggtgtcggtcaccgcgattggtgaccttgacggtcgtgccccggtg
ctgcgctccggggcgaaggccggctcggtgctggccgtcgtcggtgagctgggccgctcg
gctgctggctatgcgctgtggtgcaacgggattgaagacttcgccgaactgcgccgccgc
catttggtgccgcagccgccctacggccacggcgcggcggccgcggctgtcggggctcaa
gcgatgatcgatgtctccgacgggctgctcgccgatctgcggcacatcgccgaggcatcc
ggcgtgcgcatcgacctgtccgccgcggcgttggccgctgaccgcgacgctttgactgcg
gccgcaaccgctctgggcaccgacccctggccgtgggtgctaagcgggggtgaagatcat
gccctggtcgcctgtttcgtcggtccggtgccggccgggtggcgcaccattggccgggtt
ctcgacgggccggctagggtgctggtcgacggcgaggagtggactggatacgcgggctgg
caatcgtttggggagccagacaatcaaggttcgctagggtga

DBGET integrated database retrieval system