KEGG   Mycobacterium africanum: MAF_29880Help
Entry
MAF_29880         CDS       T01575                                 

Definition
(GenBank) conserved hypothetical alanine rich protein
  KO
K14941  
2-phospho-L-lactate guanylyltransferase [EC:2.7.7.68]
Organism
maf  Mycobacterium africanum
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Module
F420 biosynthesis
Brite
KEGG Orthology (KO) [BR:maf00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    MAF_29880
Enzymes [BR:maf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.68  2-phospho-L-lactate guanylyltransferase
     MAF_29880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3318057..3318701
Genome map
AA seq 214 aa AA seqDB search
MSGTPDDGDIGLIIAVKRLAAAKTRLAPVFSAQTRENVVLAMLVDTLTAAAGVGSLRSIT
VITPDEAAAAAAAGLGADVLADPTPEDDPDPLNTAITAAERVVAEGASNIVVLQGDLPAL
QTQELAEAISAARHHRRSFVADRLGTGTAVLCAFGTALHPRFGPDSSARHRRSGAVELTG
AWPGLRCDVDTPADLTAARQLGVGPATARAVAHR
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcacaccggacgacggcgatatcggcttgatcatcgccgtcaagcgcttggcc
gcggccaaaaccaggctggccccggtgttctcggcgcagactcgcgagaacgtggtgctg
gccatgctcgtcgacacgttgaccgccgcggcgggtgtcggttcactgcgctcgatcact
gttatcacccccgacgaagccgcggcggctgcggcggccgggctgggcgccgatgtactg
gccgacccgacacccgaagacgatcccgacccactgaacaccgccatcaccgctgccgaa
cgcgtggttgccgaaggggcctccaacatcgttgtgctgcaaggcgatttgccggcatta
cagacacaggaactcgccgaggcaatctcggccgcacgccaccatcggcgcagcttcgtc
gccgaccggcttgggaccggcaccgcggtactgtgtgcgttcggcaccgcgctgcacccg
cggttcgggccggattcgtccgcgcggcaccgccgttcgggcgctgtcgagctgacagga
gcctggccgggcctgcgctgcgatgtcgacacccccgccgacctgacggccgcacgccag
ctcggggtagggcccgcgaccgcgcgagcggtcgcacatcgttga

DBGET integrated database retrieval system