KEGG   Mycobacterium africanum: MAF_29910Help
Entry
MAF_29910         CDS       T01575                                 

Gene name
hupB
Definition
(GenBank) putative DNA-binding protein HU homolog HUPB (histone-like protein)
  KO
K03530  
DNA-binding protein HU-beta
Organism
maf  Mycobacterium africanum
Brite
DNA replication proteins [BR:maf03032]
 Prokaryotic Type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    MAF_29910 (hupB)
Chromosome [BR:maf03036]
 Prokaryotic Type
  Nucleoid associated proteins
   HU (heat unstable protein)
    MAF_29910 (hupB)
DNA repair and recombination proteins [BR:maf03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHIIR (short-homology-independent illegitimate recombination)
     Supressor
      MAF_29910 (hupB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3322115..3322759)
Genome map
AA seq 214 aa AA seqDB search
MNKAELIDVLTQKLGSDRRQATAAVENVVDTIVRAVHKGDSVTITGFGVFEQRRRAARVA
RNPRTGETVKVKPTSVPAFRPGAQFKAVVSGAQRLPAEGPAVKRGVGASAAKKVAKKAPA
KKATKAAKKAATKAPARKAATKAPAKKAATKAPAKKAVKATKSPAKKVTKAVKKTAVKAS
VRKAATKAPAKKAAAKRPATKAPAKKATARRGRK
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaagcagagctcattgacgtgctcacacagaaattgggctcggaccgtcggcag
gcgaccgccgccgtcgagaatgtcgttgacacgattgtgcgtgcggtacacaaaggcgac
agcgtcaccattaccgggttcggtgtgttcgaacagcgtcgccgcgcggctcgagtggcc
cgcaatccgcgtaccggcgagacagtaaaggtgaagccgacgtcggtgccggcgttccgc
ccgggcgcgcaattcaaagcggttgtgtctggcgcgcagcgtctcccggcagaaggaccc
gctgttaagcgtggtgtgggggccagtgcagccaagaaggtagcgaagaaggcacctgcc
aagaaggcgacaaaggccgccaagaaggcggcgaccaaggcgcccgccaggaaggcggcg
accaaggcgcccgccaagaaagcggcgaccaaggcgcccgccaagaaagctgtcaaggcc
acgaagtcacccgccaagaaggtgaccaaggcggtgaagaagaccgcggtcaaggcatcg
gtgcgtaaggcggcgaccaaggcgccggcaaagaaggcagcggccaagcggccggctacc
aaggctcccgccaagaaggcaaccgctcggcggggtcgcaaatag

DBGET integrated database retrieval system