KEGG   Mycobacterium africanum: MAF_29980Help
Entry
MAF_29980         CDS       T01575                                 

Definition
(GenBank) putative 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase (HHDD isomerase)
Organism
maf  Mycobacterium africanum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3329213..3329932)
Genome map
AA seq 239 aa AA seqDB search
MTAREIAEHPFGTPTFTGRSWPLADVRLLAPILASKVVCVGKNYADHIAEMGGRPPADPV
IFLKPNTAIIGPNTPIRLPANASPVHFEGELAIVIGRACKDVPAAQAVDNILGYTIGNDV
SARDQQQSDGQWTRAKGHDTFCPVGPWIVTDLAPFDPADLELRTVVNGDVKQHARTSLMI
HDIGAIVEWISAIMTLLPGDLILTGTPAGVGPIEDGDTVSITIEGIGTLTNPVVRKGKP
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgacggcccgcgagatcgccgagcacccgttcggtacgccgaccttcaccggacgctcc
tggccgctggccgacgttcgcctgctggctccgatactggcgagcaaggtggtctgtgtc
gggaagaactatgccgatcacatcgccgaaatgggtggccggccgccggcagacccggtg
atattcctcaagcccaacaccgcgatcatcggtccgaatacgccaattcgattgcccgcc
aacgcatcaccggtgcacttcgagggtgagctggcgatcgtgatcggccgggcgtgcaag
gatgtcccggccgcccaggccgtcgacaatatcctcggctacaccatcggcaatgacgtg
tcggcccgcgatcagcagcaatccgacggtcagtggacgcgagccaaggggcacgacacc
ttctgcccggtcgggccgtggatcgtcaccgacctcgctccctttgacccggccgatctc
gagctgcgcaccgtcgtcaacggcgacgtcaaacagcacgcccgcacctcgctgatgatc
catgacatcggcgccatcgtggaatggatctcggcgataatgaccttgctgccaggtgat
ctcatcctcaccggcacacccgcgggagtcggtcccatcgaggacggcgacaccgtctcg
atcaccatcgagggaatcggcaccctcaccaatcccgtagtccgcaaaggaaagccgtga

DBGET integrated database retrieval system