KEGG   Mycobacterium africanum: MAF_29990Help
Entry
MAF_29990         CDS       T01575                                 

Definition
(GenBank) putative conserved integral membrane protein
Organism
maf  Mycobacterium africanum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3330208..3331545
Genome map
AA seq 445 aa AA seqDB search
MSRDPTGVGARWAIMIVSLGVTASSFLFINGVAFLIPRLENARGTPLSHAGLLASMPSWG
LVVTMFAWGYLLDHVGERMVMAVGSALTAAAAYAAASVHSLLWIGVFLFLGGMAAGGCNS
AGGRLVSGWFPPQQRGLAMGIRQTAQPLGIASGALVIPELAERGVHAGLMFPAVVCTLAA
VASVLGIVDPPRKSRTKASEQELASPYRGSSILWRIHAASALLMMPQTVTVTFMLVWLIN
HHGWSVAQAGVLVTISQLLGALGRVAVGRWSDHVGSRMRPVRLIAAAAAATLFLLAAVDN
EGSRYDVLLMIAISVIAVLDNGLEATAITEYAGPYWSGRALGIQNTTQRLMAAAGPPLFG
SLITTAAYPTAWALCGVFPLAAVPLVPVRLLPPGLETRARRQSVRRHRWWQAVRCHAWPN
GPRRPGPPGQPRRVRQGGTAITPPT
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgagatccgactggggtgggtgcgcgctgggcgatcatgatcgtctcgctgggg
gtgaccgcaagctcgtttctcttcatcaacggtgtcgcgttcttgatcccccggctggaa
aatgcgcgcggaaccccgctatctcacgcgggtctgttggcgtcgatgcccagctggggc
ctggtggtcacgatgttcgcctggggctatctgctcgatcacgtcggcgaacggatggtg
atggccgtgggctcggcgctgaccgccgcggccgcctacgccgcggcatcggttcattcg
ctgctgtggatcggtgtcttcctgtttctcggcggcatggccgccggtggttgcaacagc
gccggcgggcggctggtctcgggttggttcccgccccagcaacgcggtctggccatggga
atccgccagaccgcacaacctttgggcatcgcctccggcgcgttggtgatacccgaactg
gccgaacgcggggtgcacgcagggctgatgtttcccgccgtcgtgtgcacgttggccgcg
gtggccagcgtgctcggtatcgtcgacccaccgcgaaaatcccgcacgaaagcctccgaa
caggagctggccagcccttatcggggatcgtcgatcctgtggcggatacacgcggcgtcg
gcgttgctgatgatgccgcagacggtgaccgtgacgttcatgttggtctggctgatcaac
caccacggctggtcggtcgcgcaggccggtgtcttggtgaccatatcgcagctgctgggg
gcgctgggccgggtcgcggtcggccgctggtcggaccatgtcgggtcacgcatgcgtccc
gtccgcctgatcgccgctgccgccgcggcgacgttgtttctgctcgcggcggtcgataac
gagggctcgagatatgacgtgctgctcatgatcgccatctcggtgatcgccgttctggac
aacgggctagaagccaccgcgatcaccgagtacgccggaccgtactggagtggccgggcg
ctgggtatccagaacactacgcagcggctgatggcggccgccggacccccactgttcggt
agtttgatcaccacggcggcctacccgacggcatgggccttatgcggtgtgttcccgctg
gccgcggtgccgctggtgccggttcggctgctcccacccggcttggagactagagcgcgg
cggcaatccgttcgccgacatcgctggtggcaagccgttcgctgccacgcgtggccaaat
gggcctcgacggcccggtccacccgggcagccgcgtcgtgttcgccaaggtgggacagca
ataacgccaccgacatga

DBGET integrated database retrieval system