KEGG   Mycobacterium africanum: MAF_30020Help
Entry
MAF_30020         CDS       T01575                                 

Definition
(GenBank) putative alanine rich dehydrogenase
Organism
maf  Mycobacterium africanum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3334038..3335480
Genome map
AA seq 480 aa AA seqDB search
MDVTVVGSGPNGLATAVICARAGLNVQVVEAQATFGGGARSAADFEFPEVLHDVCSAVHP
LALASPFFAEFDLPARGVTLTVPDIAYANPLPGRPAAIAYHDLAHTCAKLDDGASWRRLL
GPLVAHSETVVEFMLSDKRSLPTALGSVLRLGLRMLAQGTPAWRSLAGEDARALFTGVAA
HAISPLPSLVSAGAGLMLATLAHSVGWPIPVGGTQAIADALIADLRAHGGRLAAGVEITE
PQRSVVVFDTAPTALLRVYRDKLPHRYAKALRRYRFRAGIAKVDFVLSDEIPWSDPRLRR
AATLHLGGTRDQMARAEADVAAGRHADWPMVLAACPHVADPGRIDETGRRPFWTYAHVPS
GSTLDATETVTSVLERFAPGFRDIVVAARAVPAARMADHNANYVGGDITVGANSTWRAIA
GPTPRLNPWRTPIPKVYLCSAATPPGAGVHGMCGWYAARTLLRTEFGITRMPPLGHELRP
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
gtggacgtcaccgtcgtcggcagcggacccaacgggctcgccacggccgtcatctgcgcc
cgcgcgggcctgaacgtgcaggtcgtcgaggcccaggcgaccttcggcggcggcgcccgc
agcgcggccgacttcgaatttcccgaagttttacacgacgtgtgctccgcggtgcatccg
cttgctttggcgtcgccgtttttcgccgaattcgacctacccgcgcgcggagtgacgctg
accgtgcccgacatcgcctacgccaacccgctacccgggcggcccgcggcgatcgcctat
cacgatctggcgcacacctgcgccaagctggacgacggcgcgtcctggcggcgcctgctg
ggcccgttggtggcgcactcggagacggtcgtggagttcatgctctccgacaagcggtct
ttgcctactgcactgggctcggtcctgcgtctcgggctgcggatgctggcccagggcacc
cctgcctggcggtcgctggcgggcgaggatgcccgcgcgttgttcaccggcgttgccgcc
cacgcgatttcaccgttgccgtcactggtgtcggccggcgccggactgatgctggcaacg
ctggcccattcggtcggctggccgattccggtgggcggcacccaggcgatagccgacgcg
ctgatcgccgatctacgcgcgcatggtggtcggctcgcggccggtgtcgagatcaccgaa
ccgcaaagaagtgtggtcgtcttcgacaccgcacccaccgccctgctgcgggtttaccgc
gacaagcttccacatcggtatgccaaagcattgcgccgctatcgatttcgcgctggcatc
gccaaggtggacttcgtgctcagcgacgagatcccgtggtcggatccgcggctgcggcgg
gctgcgaccctgcatctcggcggcacccgtgaccagatggcgcgcgccgaggcagacgtc
gcggcgggacgccacgccgactggccgatggtgctggccgcgtgtccgcacgtcgccgac
cccggccgcatcgacgaaaccggccgccgtccgttctggacctatgcccacgtgccgtcg
gggtccacgctcgacgcgaccgagaccgtaaccagcgtcctcgagcggttcgcccccggc
ttccgtgacatcgtggtggcggcccgcgccgtgcccgccgcgcggatggccgaccacaac
gccaactacgtcggcggtgacatcacggtcggcgccaactcgacctggcgcgcgatcgcc
ggccccaccccgcggttgaatccctggcgcacaccgattcccaaggtgtacctgtgttct
gcggcgactccgcccggcgccggcgtgcacggcatgtgcggctggtatgccgctcgaacg
ctgttgcgcaccgagttcggcatcacccgcatgccccccttgggccatgagctgaggcca
taa

DBGET integrated database retrieval system