KEGG   Mycobacterium africanum: MAF_30090Help
Entry
MAF_30090         CDS       T01575                                 

Gene name
ilvB1
Definition
(GenBank) putative acetolactate synthase (large subunit) ILVB1 (acetohydroxy-acid synthase)
  KO
K01652  
acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
maf  Mycobacterium africanum
Pathway
Valine, leucine and isoleucine biosynthesis
Butanoate metabolism
C5-Branched dibasic acid metabolism
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:maf00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    MAF_30090 (ilvB1)
   00660 C5-Branched dibasic acid metabolism
    MAF_30090 (ilvB1)
  Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    MAF_30090 (ilvB1)
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    MAF_30090 (ilvB1)
Enzymes [BR:maf01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     MAF_30090 (ilvB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3340069..3341925)
Genome map
AA seq 618 aa AA seqDB search
MSAPTKPHSPTFKPEPHSAANEPKHPAARPKHVALQQLTGAQAVIRSLEELGVDVIFGIP
GGAVLPVYDPLFDSKKLRHVLVRHEQGAGHAASGYAHVTGRVGVCMATSGPGATNLVTPL
ADAQMDSIPVVAITGQVGRGLIGTDAFQEADISGITMPITKHNFLVRSGDDIPRVLAEAF
HIAASGRPGAVLVDIPKDVLQGQCTFSWPPRMELPGYKPNTKPHSRQVREAAKLIAAARK
PVLYVGGGVIRGEATEQLRELAELTGIPVVTTLMARGAFPDSHRQNLGMPGMHGTVAAVA
ALQRSDLLIALGTRFDDRVTGKLDSFAPEAKVIHADIDPAEIGKNRHADVPIVGDVKAVI
TELIAMLRHHHIPGTIEMADWWAYLNGVRKTYPLSYGPQSDGSLSPEYVIEKLGEIAGPD
AVFVAGVGQHQMWAAQFIRYEKPRSWLNSGGLGTMGFAIPAAMGAKIALPGTEVWAIDGD
GCFQMTNQELATCAVEGIPVKVALINNGNLGMVRQWQSLFYAERYSQTDLATHSHRIPDF
VKLAEALGCVGLRCEREEDVVDVINQARAINDCPVVIDFIVGADAQVWPMVAAGTSNDEI
QAARGIRPLFDDITEGHA
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcaccaaccaagccacactcaccgacattcaagccagagccacacagcgcggcg
aatgagccaaagcacccggcggctcgtccgaaacatgttgcactgcagcagcttaccggt
gcacaggcggtcatccggtcgctggaggaactcggcgtcgacgtcattttcgggattccg
ggcggtgcggtgctgccggtgtatgacccgctgttcgactcgaaaaagctgcgccacgtg
ctggtccgccacgaacagggcgccgggcatgccgccagcggctacgcgcacgtcaccggc
cgggtgggcgtgtgcatggcaacgtcgggtcccggagcgaccaacctggtgaccccgctg
gccgacgcgcagatggactcgatcccggtggtcgctatcaccggtcaggtcgggcggggg
ctgatcggcaccgacgccttccaggaggccgacatctcgggcatcacgatgccgatcacc
aagcacaactttctggtccgctccggtgacgacattccgcgggtgctggccgaggccttc
cacatcgcggcctccggccgtccgggcgcggtgctggtcgacatccccaaggacgtgctg
cagggccagtgcacgttcagctggccgccgcggatggagctgcccggctacaagcccaac
accaaaccgcacagccggcaggtccgcgaggccgccaagctgatcgcggccgcgcgcaag
ccggtgctgtatgtcggcggcggcgtcatccgcggtgaggccaccgagcagctccgggag
ctggccgagctgaccggcatcccggtggtcaccacgctgatggcccgcggcgcgtttccc
gacagccaccggcaaaacctcggcatgcccggcatgcacggcacggtggccgccgtggcg
gcgctgcagcgcagcgacctgctgatcgcgctgggtacccgcttcgacgaccgggtgacc
ggcaagctcgactcgttcgcgccggaagccaaggtcatccacgccgacatcgacccggcc
gagatcggcaagaaccgccacgccgacgtgcccatcgtcggtgacgtcaaggccgtcatc
accgaactgatcgcgatgctgcgccaccaccacattcccggcaccatcgagatggccgac
tggtgggcatacctgaacggtgtgcgcaagacctatccgctgagctatgggccgcagagc
gacggcagcctgagcccggaatacgtgatcgaaaagctcggcgagatcgccgggccggac
gccgtcttcgtcgccggcgtcggccagcaccagatgtgggccgcgcagttcatcagatac
gaaaagccgcgcagctggctgaactccggcggtctgggcaccatggggtttgccatcccg
gcggccatgggcgccaagatcgccctccccggcaccgaggtctgggcgatcgacggcgac
ggttgcttccagatgaccaaccaggagctggccacctgcgcggtcgagggcataccggtc
aaggtggcgctgatcaacaacggcaacctgggcatggtgcggcagtggcagagcctgttc
tatgccgagcggtactcgcagaccgacctggccactcattcgcaccgcatccccgacttc
gtgaaactggccgaggccttggggtgtgtggggttgcggtgcgagcgggaagaggacgtc
gtcgacgtcatcaaccaggcgcgggcgatcaacgactgcccggtggtgatcgacttcatc
gtcggtgccgacgcgcaagtgtggccgatggtggccgcgggcaccagcaatgacgagatc
caggccgcccgcggcattcgccccctgttcgacgacatcaccgaaggccacgcctga

DBGET integrated database retrieval system