KEGG   Mycobacterium africanum: MAF_30100Help
Entry
MAF_30100         CDS       T01575                                 

Gene name
cfp6
Definition
(GenBank) low molecular weight protein antigen 6 (CFP-6)
Organism
maf  Mycobacterium africanum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3342287..3342625
Genome map
AA seq 112 aa AA seqDB search
MAHFAVGFLTLGLLVPVLTWPVSAPLLVIPVALSASIIRLRTLADERGVTVRTLVGSRAV
RWDDIDGLRFHRGSWARATLKDGTELRLPAVTFATLPHLTEASSGRVPNPYR
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atggcgcacttcgccgtgggattcctgaccctgggtctgctggtgccggtactgacctgg
ccggtgagcgccccgctgttagtcattccggtggcgttgtcggcatcgatcattcggctc
cgcacgctcgccgacgagcggggcgtgaccgtgcggacgctggtcggcagccgcgcggtg
cgctgggacgacatcgacgggctgcggttccaccgcgggtcctgggcgcgcgcaacgctc
aaggacggtaccgagctgcgattgcccgcggtgacctttgcgacgctgccgcacctgacc
gaagccagctcgggacgggtccccaacccgtaccgatga

DBGET integrated database retrieval system