KEGG   Mycobacterium africanum: MAF_30190Help
Entry
MAF_30190         CDS       T01575                                 

Definition
(GenBank) conserved hypothetical protein
Organism
maf  Mycobacterium africanum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3350754..3351410
Genome map
AA seq 218 aa AA seqDB search
MRSYLLRIELADRPGSLGSLAVALGSVGADILSLDVVERGNGYAIDDLVVELPPGAMPDT
LITAAEALNGVRVDSVRPHTGLLEAHRELELLDHVAAAEGATARLQVLVNEAPRVLRVSW
CTVLRSSGGELHRLAGSPGAPETRANSAPWLPIERAAALDGGADWVPQAWRDMDTTMVAA
PLGDTHTAVVLGRPGPEFRPSEVARLGYLAGIVATMLR
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
gtgcgttcgtatctattgcgtatcgagctggccgaccggccgggcagccttgggtcgctg
gcggtcgcgctcggctcggtgggcgccgacatcctctcgctcgacgtggtcgagcgcggc
aacggctatgcgatcgacgacctggtggtcgaactgcccccgggagcgatgcccgacacg
ctgatcactgctgccgaggcgctgaacggcgtccgggtagacagcgtccgcccgcacacc
ggcctgttggaagcccaccgcgagctggaactgctcgatcatgtggccgcggctgagggc
gcgaccgcacggctccaggttctggtcaacgaggccccccgggtgctccgggtgagctgg
tgcacggtgttgcgcagttccggcggggagctgcaccgtctggccggcagcccaggtgcg
ccggagacccgggccaattcggcgccctggctgccgatcgagcgggccgcggcgctggac
ggcggcgccgactgggtgccgcaagcctggcgcgacatggataccaccatggtcgcggct
ccattgggtgacacgcacaccgcggtggtgctgggcaggccaggcccggaatttcgcccg
tcggaggtggcgcggttgggttatctagccggcatcgtggcgacgatgctgcgctga

DBGET integrated database retrieval system