KEGG   Mycobacterium africanum: MAF_30240Help
Entry
MAF_30240         CDS       T01575                                 

Gene name
PPE46
Definition
(GenBank) PPE family protein
Organism
maf  Mycobacterium africanum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3355878..3357182)
Genome map
AA seq 434 aa AA seqDB search
MTAPVWLASPPEVHSALLSAGPGPGSLQAAAAGWSALSAEYAAVAQELSVVVAAVGAGVW
QGPSAELFVAAYVPYVAWLVQASADSAAAAGEHEAAAAGYVCALAEMPTLPELAANHLTH
AVLVATNFFGINTIPIALNEADYVRMWVQAATVMSAYEAVVGAALVATPHTGPAPVIVKP
GANEASNAVAAATITPFPWHEIVQFLEETFAAYDQYLSALLSELPAVAWVWFQLFVDILG
FNIIGFIITLASNAQLLTEFAINASYVAVGLLYAIAGVIDIVVEWVIGNLFGVVPLLGGP
LLGALAAAVVPGVAGLAGVAGLAALPAVGAAAGAPAALVGSVAPVSGGVVSPQARLVSAV
EPAPASTSVSVLASDRGAGALGFVGTAGKESVGQPAGLTVLADEFGDGAPVPMLPGSWGP
DLVGVAGDGGLVSV
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
gtgacggcgccggtgtggttggcgtcgccgccggaggtgcattcggcgctgctaagtgct
ggtccggggccgggttcgttgcaggcggccgcggcggggtggagcgcgttaagcgccgag
tacgccgctgtggcgcaagagttgagcgtggtggtggccgcggtgggggccggggtgtgg
cagggtcccagtgctgagttgtttgtggccgcctatgtgccgtatgtggcgtggttggtg
caggccagtgcggatagcgcggcggcggccggtgagcatgaggccgcggcggctggctat
gtttgtgcgttggcggagatgccgacgttgccggagttggcggccaaccacctcacgcat
gcggtgttggtggcgacgaatttctttgggatcaacacgatcccgatcgcgctcaacgag
gccgactatgtgcggatgtgggtccaggcggccaccgtgatgagcgcctatgaggcggtg
gtgggtgccgcgctggtggccacaccacacaccggcccggcaccggtcatcgtcaaaccc
ggcgccaatgaagccagcaacgccgtggccgccgcaaccataaccccattcccatggcac
gaaattgtacagtttttagaagaaacgttcgcagcatatgaccagtatctgtccgctttg
ctttccgaactccctgcggtggcttgggtttggttccagctctttgtggatatcctgggt
ttcaacattattgggttcattattacgttggcatccaatgctcaactattgacagagttc
gctatcaatgcttcttatgttgcggtcggattattgtatgccattgcgggcgttatagac
atagttgtcgagtgggttattgggaatctgtttggtgttgttccccttttgggggggccg
ttgttgggggcgttggccgctgctgtggttccgggtgtagctgggttggccggggtggcg
ggattggccgctctgccggcggtgggtgcggctgctggcgcgccggcggcgttggtgggc
agtgtggcgccggtgtcgggtggtgtggtgtcgccgcaggcgcggttggtgtcggcggtg
gagccggctcccgcgagcacgtcggtgtcggtgctggcttctgatcggggtgctggggcg
ttggggtttgttgggacggctggcaaggagtcggttgggcagccggcggggttgacggtg
ttggccgatgagtttggtgatggtgcgccggtgccgatgctgccgggcagctgggggccg
gatttggtcggtgtggccggtgatggggggttggtgtcagtttga

DBGET integrated database retrieval system