KEGG   Mycobacterium africanum: MAF_30260Help
Entry
MAF_30260         CDS       T01575                                 

Gene name
esxR
Definition
(GenBank) secreted ESAT-6 like protein ESXR (TB10.3) (ESAT-6 like protein 9)
Organism
maf  Mycobacterium africanum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3357650..3357940)
Genome map
AA seq 96 aa AA seqDB search
MSQIMYNYPAMMAHAGDMAGYAGTLQSLGADIASEQAVLSSAWQGDTGITYQGWQTQWNQ
ALEDLVRAYQSMSGTHESNTMAMLARDGAEAAKWGG
NT seq 291 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcagattatgtacaactatccggcgatgatggctcatgccggggacatggccggt
tatgcgggcacgctgcagagcttgggggccgatatcgccagtgagcaggccgtgctgtcc
agtgcttggcagggtgataccgggatcacgtatcagggctggcagacccagtggaaccag
gccctagaggatctggtgcgggcctatcagtcgatgtctggcacccatgagtccaacacc
atggcgatgttggctcgagatggggccgaagccgccaagtggggcggctag

DBGET integrated database retrieval system