KEGG   Mycobacterium africanum: MAF_30300Help
Entry
MAF_30300         CDS       T01575                                 

Definition
(GenBank) putative transposase
  KO
K07493  
putative transposase
Organism
maf  Mycobacterium africanum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3360315..3361562)
Genome map
AA seq 415 aa AA seqDB search
MTSSHLIDTEQLLADQLAQASPDLLRGLLSTFIAALMGAEADALCGAGYRERSDERSNQR
NGYRHRDFDTRAATIDVAIPKLRQGSYFPDWLLQRRKRAERALTSVVATCYLLGVSTRRM
ERLVETLGVTKLSKSQVSIMAKELDEAVEAFRTRPLDAGPYTFLAADALVLKVREAGRVV
GVHTLIATGVNAEGYREILGIQVTSAEDGAGWLAFFRDLVARGLSGVALVTSDAHAGLVA
AIGATLPAAAWQRCRTHYAANLMAATPKPSWPWVRTLLHSIYDQPDAESVVAQYDRVLDA
LTDKLPAVAEHLDTARTDLLAFTAFPKQIWRQIWSNNPQERLNREVRRRTDVVGIFPDRA
SIIRLVGAVLAEQHDEWIEGRRYLGLEVLTRARAALTSTEEPAKQQTTNTPALTT
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgacctcttctcatcttatcgacaccgagcagcttctggctgaccaactcgcacaggcg
agcccggatctgctgcgcgggctgctctcgacgttcatcgccgccttgatgggggctgaa
gccgacgccctgtgcggggcgggctaccgcgaacgcagcgatgagcggtccaatcagcgc
aacggctaccgccaccgtgatttcgacacccgtgccgcaaccatcgacgtcgcgatcccc
aagctgcgccagggcagctatttcccggactggctgctgcagcgccgcaagcgagctgaa
cgcgcactgaccagcgtggtggcgacctgctacctgctgggagtatccactcgccggatg
gagcgcctggtcgaaacacttggtgtgacaaagctttccaagtcgcaagtgtcgatcatg
gccaaagagctcgacgaagccgtagaggcgtttcggacccgcccgctcgatgccggcccg
tataccttcctcgccgccgacgccctggtgctcaaggtgcgcgaggcaggccgcgtcgtc
ggagtgcacaccttgatcgccaccggcgtcaacgccgagggctaccgagagatcctgggc
atccaggtcacctccgccgaggacggggccggctggctggcgttcttccgcgacctggtc
gcccgcggcctgtccggggtcgcgctggtcaccagcgacgcccacgccggcctggtggcc
gcgatcggcgccaccctgcccgcagcggcctggcagcgctgcagaacccactacgcagcc
aatctgatggcagccaccccgaagccctcctggccgtgggtgcgcaccctgctgcactcc
atctacgaccagcccgacgccgaatcagttgttgcccaatatgatcgggtactcgacgct
ctgaccgacaaactccccgcggtggccgagcacctcgacaccgcccgcaccgacctgctg
gcgttcaccgccttccccaagcagatctggcgccaaatctggtccaacaacccccaggaa
cgcctcaaccgagaggtacgacgccgaaccgacgtcgtgggcatcttccccgaccgcgcc
tcgatcatccgcctcgtcggagccgtcctcgccgaacaacacgacgaatggatcgaagga
cggcgctacctgggcctcgaggtcctcacccgagcccgagcagcactgaccagcaccgaa
gaacccgccaagcagcaaaccaccaacaccccagcactgaccacctag

DBGET integrated database retrieval system