KEGG   Mycobacterium africanum: MAF_30400Help
Entry
MAF_30400         CDS       T01575                                 

Definition
(GenBank) hypothetical protein
Organism
maf  Mycobacterium africanum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3372320..3372868
Genome map
AA seq 182 aa AA seqDB search
MAHSIVRTLLASGAATALIAIPTACSFSIGTSHSHSVSKAEVARQITAKMTDAAGNKPES
VTCPSDLPAEVGAELNCEMKIKDRTFNVNVTVTSVDGSDVKFDMVETVDKNQVANIISDK
LFQRVGARPDSVTCPDNLKGVEGAKLRCRLTDGSKTYGISVIVTSVDAGDVNFDFKVDDH
PE
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atggctcactcgatcgttcgcacgctgctggcctcaggtgccgccacggccctgatcgcc
attcccacagcctgctcgttttcgatcggaacgtcgcactcgcactcggtgagcaaggcc
gaggtcgcccggcagatcaccgccaagatgacagacgccgccggcaacaagcccgaatcg
gtgacgtgcccaagcgatctcccggcagaggtcggggccgagctgaattgcgaaatgaag
atcaaggaccgcacgttcaacgtcaacgtcaccgtgaccagtgtcgacggtagcgacgtc
aagttcgacatggtggagaccgtcgacaagaaccaggttgccaacatcatcagcgacaaa
ctgttccagcgggtgggcgccaggcccgattcggtgacctgccccgacaatctaaagggc
gtcgagggagccaaactgcggtgtcgactgaccgacggcagcaaaacgtatggcatctcg
gtgattgtcaccagcgttgacgccggcgatgtcaacttcgatttcaaggtcgatgaccac
cccgagtag

DBGET integrated database retrieval system