KEGG   Mycobacterium africanum: MAF_30420Help
Entry
MAF_30420         CDS       T01575                                 

Definition
(GenBank) conserved hypothetical protein
Organism
maf  Mycobacterium africanum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3374319..3375401
Genome map
AA seq 360 aa AA seqDB search
MAAGPALSARGYLALNGQTPAGCSLMEWQNDNNGRQRWCVRLVQGGGFAGPLFDGFDNLY
VGQPGAIISFPPTQWTRWRQPVIGMPSTPRFLGHGRLLVSTHLGQLLVFDTRRGMVVGSP
VDLVDGIDPTDATRGLADCAPARPGCPVAAAPAFSSFNGTVVVSVWQPGEPAAKLVGLKY
HAEQLVREWTSDAVSAGVLASPVLSADGSTVYVNGRDHRLWALNAADGKAKWSAPLGFLA
QTPPALTPHGLIVSGGGPDTALAAFRDAGDHAEGAWRRDDVTALSTASLAGTGVGYTVIS
GPNHDGTPGLSLLVFDPANGHTVNSYPLPGATGYPVGVSVGNDRRVVTATSDGQVYSFAP
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
ttggctgccggaccagccctgagcgcacgcgggtacctcgcgttaaacgggcagaccccg
gccgggtgttcgctgatggagtggcagaacgacaacaacggccggcagcgctggtgtgtg
cggctggtccagggcggcggcttcgccggcccgttgttcgacggcttcgacaacctctac
gtcggccagccgggagcgataatctcctttccgccgacccagtggacgcgctggcgccag
cccgtgatcgggatgccgtccaccccgcggtttctggggcatggccgcctgctcgtgagt
acacacctggggcagctgctggtattcgatacccgccgcggcatggtggtcggcagtccg
gtggacctggtggacggcatcgatcccaccgatgcgacacgcggactggccgactgcgcg
ccagcccggccgggctgcccggtcgcggccgcccctgcgttctcgtcgttcaacggcacg
gtggtggtcagcgtctggcagccgggcgaaccggccgcgaagctggtcgggctgaaatac
cacgctgagcaactcgtccgcgagtggaccagtgacgctgtcagcgcgggcgtgctggcc
agcccagtgctctccgccgacggatcgacggtctacgtcaatgggcgcgaccaccggcta
tgggcactcaacgccgccgacgggaaagcgaagtggtcagctcccctgggctttctggcg
cagacgccgcccgcactgaccccacatggactgatcgtgtccggcgggggccccgacacc
gcgctggcggcgttccgggatgccggtgatcacgccgagggggcctggcgacgcgacgac
gttactgcgctgtcgaccgcgagtctggccggcaccggcgtcggctatacggtcatcagc
ggtccaaaccacgatggcacgcccggtttgtcgttgctggtcttcgatccggccaacggc
cacacggtcaacagctatccgctacccggagcgaccggatatcccgtcggtgtatcggtc
ggcaacgaccgccgcgtggtgaccgccaccagcgacggccaggtctacagcttcgcacct
tag

DBGET integrated database retrieval system