KEGG   Mycobacterium africanum: MAF_30490Help
Entry
MAF_30490         CDS       T01575                                 

Gene name
serB2
Definition
(GenBank) putative phosphoserine phosphatase SERB2 (PSP) (O-phosphoserine phosphohydrolase)
  KO
K01079  
phosphoserine phosphatase [EC:3.1.3.3]
Organism
maf  Mycobacterium africanum
Pathway
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Serine biosynthesis, glycerate-3P => serine
Brite
KEGG Orthology (KO) [BR:maf00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    MAF_30490 (serB2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MAF_30490 (serB2)
Enzymes [BR:maf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.3  phosphoserine phosphatase
     MAF_30490 (serB2)
Protein phosphatases and associated proteins [BR:maf01009]
 HAD phosphatases
  Other HAD phosphatases
   MAF_30490 (serB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3380873..3382102)
Genome map
AA seq 409 aa AA seqDB search
MPAKVSVLITVTGMDQPGVTSALFEVLAQHGVELLNVEQVVIRGRLTLGVLVSCPLDVAD
GTALRDDVAAAIHGVGLDVAIERSDDLPIIRQPSTHTIFVLGRPITAGAFSAVAREVAAL
GVNIDFIRGISDYPVTGLELRVSVPPGCVGPLQIALTKVAAEEHVDVAVEDYGLAWRTKR
LIVFDVDSTLVQGEVIEMLAARAGAQGQVAAITEAAMRGELDFAESLQRRVATLAGLPAT
VIDDVAEQLELMPGARTTIRTLRRLGFRCGVVSGGFRRIIEPLARELMLDFVASNELEIV
DGILTGRVVGPIVDRPGKAKALRDFASQYGVPMEQTVAVGDGANDIDMLGAAGLGIAFNA
KPALREVADASLSHPYLDTVLFLLGVTRGEIEAADAGDCGVRRVEIPAD
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgccagccaaggtgtcggtgctgatcacggtcaccggcatggatcagccaggcgtgaca
tccgcgctcttcgaggtgctcgcgcagcacggagtcgagctgctcaacgtcgaacaagtg
gtgatccggggccggctcacgctgggtgtgctggtgtcgtgcccgctggacgttgccgac
ggtaccgcgctgcgcgacgacgtcgcggccgccatccacggggtgggtctagacgtcgcc
atcgagcgcagcgacgatctgccaatcattcggcaaccgtccacccacaccattttcgtg
ctgggacgcccgattaccgccggagcgttcagcgcggtggccagggaagtggccgcactc
ggcgtcaacatcgacttcatccgcggcatttccgactacccggtcaccggcctggagttg
cgggtctcggtgccgcctggatgcgtgggtccgctgcagatcgccctgaccaaggtggcc
gccgaagagcatgtcgatgtggccgtcgaggactacggcttggcttggcgcaccaaacgc
ctgatcgtcttcgacgtcgactccactctggtccaaggcgaggtcatcgagatgctggca
gcccgtgcgggtgcccagggacaggtcgccgcgatcaccgaggccgcgatgcgtggtgag
ctggacttcgccgagtcgctgcagcgtcgtgttgccaccttggcggggctgcccgcgacg
gtgatagacgacgtcgccgagcagctcgaactgatgcccggtgctcggaccacgatccgg
accttgcggcgtctgggttttcgctgcggtgtggtttccggcggctttcggcggatcatc
gagccgctcgcacgcgagttgatgttggatttcgttgcgtccaacgagctggaaatcgtc
gatggcattcttaccggccgggtcgtggggccgattgttgaccggcccggcaaggccaag
gcgcttcgggacttcgcgagccagtatggggtgccgatggagcagaccgtcgcggtcggc
gacggcgccaacgatatcgacatgctgggcgcggccgggctgggaatagcattcaacgcc
aagccggcgttgcgtgaggtcgccgatgcgtcgttgagccatccgtacctggacacggtg
ttgttcttgttgggcgtgactcgcggtgagatcgaggccgccgacgccggcgactgtggg
gtgcgtcgcgtcgaaatcccggccgactag

DBGET integrated database retrieval system