KEGG   Mycobacterium africanum: MAF_30500Help
Entry
MAF_30500         CDS       T01575                                 

Gene name
ctaD
Definition
(GenBank) putative cytochrome C oxidase polypeptide I CTAD (cytochrome AA3 SUBUNIT 1)
  KO
K02274  
cytochrome c oxidase subunit I [EC:1.9.3.1]
Organism
maf  Mycobacterium africanum
Pathway
Oxidative phosphorylation
Metabolic pathways
Module
Cytochrome c oxidase, prokaryotes
Brite
KEGG Orthology (KO) [BR:maf00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    MAF_30500 (ctaD)
Enzymes [BR:maf01000]
 1. Oxidoreductases
  1.9  Acting on a heme group of donors
   1.9.3  With oxygen as acceptor
    1.9.3.1  cytochrome-c oxidase
     MAF_30500 (ctaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3382140..3383861)
Genome map
AA seq 573 aa AA seqDB search
MTAEAPPLGELEAIRPYPARTGPKGSLVYKLITTTDHKMIGIMYCVACISFFFIGGLLAL
LMRTELAAPGLQFLSNEQFNQLFTMHGTIMLLFYATPIVFGFANLVLPLQIGAPDVAFPR
LNAFSFWLFVFGATIGAAGFITPGGAADFGWTAYTPLTDAIHSPGAGGDLWIMGLIVAGL
GTILGAVNMITTVVCMRAPGMTMFRMPIFTWNIMVTSILILIAFPLLTAALFGLAADRHL
GAHIYDAANGGVLLWQHLFWFFGHPEVYIIALPFFGIVSEIFPVFSRKPIFGYTTLVYAT
LSIAALSVAVWAHHMFATGAVLLPFFSFMTYLIAVPTGIKFFNWIGTMWKGQLTFETPML
FSVGFMVTFLLGGLTGVLLASPPLDFHVTDSYFVVAHFHYVLFGTIVFATFAGIYFWFPK
MTGRLLDERLGKLHFWLTFIGFHTTFLVQHWLGDEGMPRRYADYLPTDGFQGLNVVSTIG
AFILGASMFPFVWNVFKSWRYGEVVTVDDPWGYGNSLEWATSCPPPRHNFTELPRIRSER
PAFELHYPHMVERLRAEAHVGRHHDEPAMVTSS
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
ttgacagccgaagcgcccccgctgggagaactcgaagccattcgtccttacccggcccgc
accggtcccaaggggagcctggtctacaagctgatcaccaccaccgatcacaagatgatc
ggcatcatgtactgcgtcgcgtgcataagctttttcttcatcggtggcctgctggcgttg
ttgatgcggaccgagctggccgcacccggtctgcagttcttgtcgaatgagcagttcaac
cagttgttcaccatgcacggcacgatcatgctgctgttctatgccacgccgattgtgttt
ggtttcgccaacctggtgctgccgctgcagatcggcgcacccgacgtggccttcccccgg
ctgaacgccttttcgttctggctgttcgtatttggcgccaccatcggggcagccggcttc
atcactccgggcggggccgcggacttcgggtggaccgcctacacgccgctgaccgacgcc
attcactcgcccggcgccgggggcgacctgtggatcatgggtttgatcgttgcgggtctg
ggcaccatcctgggcgcggtcaacatgatcaccaccgtggtgtgcatgcgcgcacccggg
atgacgatgttccggatgccgatcttcacctggaacatcatggtgacgtccatcctgata
ttgattgcgttcccgctgctcacggcggcattgttcgggctggccgccgaccggcatctg
ggagctcacatctatgacgccgccaatggcggagtcctgctgtggcagcacctgttttgg
ttcttcggccaccccgaggtctacatcatcgcgctgccgtttttcgggatcgtctcggag
atcttcccggtgttttcccgcaagccgatcttcggttacaccacgctggtttatgcgacg
ctgtcgatcgccgcgttgtcggtcgcggtatgggcgcaccacatgttcgcgaccggagcc
gtcctgcttcccttcttctctttcatgacgtatctgatcgcggtgccgaccgggatcaag
tttttcaactggatcggcaccatgtggaaggggcaattgacctttgaaaccccgatgttg
ttttcggtgggcttcatggtcaccttcttgctgggcggactcaccggtgtgctgctggcc
agcccgccgctggacttccacgtcaccgatagctatttcgtggttgcacactttcactac
gtgctgttcggcacgatcgtgttcgccaccttcgccggcatctatttctggttccccaag
atgaccggccggctgctcgacgagcggttgggcaaactgcacttctggttgacgttcatc
ggttttcacaccacgttcctggtgcagcactggttgggcgacgagggtatgccgcgtcgc
tacgccgactacctacccaccgacggcttccagggtctcaacgtcgtctcgacgatcggg
gccttcatcctgggtgcgtcgatgttcccgttcgtgtggaacgtcttcaagagctggcgc
tacggcgaggtggtcaccgtcgacgacccgtgggggtacgggaattcgctggagtgggcg
acaagttgtccgccgccgcggcacaacttcaccgagctgcctcgcatccgctccgagcgt
cccgcgttcgaactgcactacccgcatatggtggaacgccttcgcgccgaggcccacgtc
gggcgtcatcatgacgagcccgccatggtgacttcgagctga

DBGET integrated database retrieval system