KEGG   Mycobacterium africanum: MAF_30540Help
Entry
MAF_30540         CDS       T01575                                 

Definition
(GenBank) hypothetical protein
Organism
maf  Mycobacterium africanum
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3386962..3387246)
Genome map
AA seq 94 aa AA seqDB search
MGGPFDADAEAHFDEVAEAFAKLTNVDRDVGVDLEKELCMTVEADDRSDALVTRRLLPRV
PRCIPLAARLAPGTIGCPSFWNPIATGGASRQAL
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
atgggcggaccgttcgatgcggacgcggaggcgcatttcgacgaggttgccgaggcattc
gccaagctcaccaatgtggaccgcgacgtcggcgtagacctggagaaggagctgtgcatg
acggtggaggccgatgaccgctcggacgcgctcgtcacaaggcgtttgttgccgcgcgta
ccgcggtgcataccgctggcggcgcgactggcacctgggacaattggctgcccaagcttc
tggaatccgatagctaccggtggagcgtcacgccaagctctttga

DBGET integrated database retrieval system