KEGG   Mycobacterium africanum: MAF_30590Help
Entry
MAF_30590         CDS       T01575                                 

Gene name
nrdI
Definition
(GenBank) putative NRDI protein
  KO
K03647  
protein involved in ribonucleotide reduction
Organism
maf  Mycobacterium africanum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3393172..3393624)
Genome map
AA seq 150 aa AA seqDB search
MDIAGRSLVYFSSVSENTHRFVQKLGIPATRIPLHGRIEVDEPYVLILPTYGGGRANPGL
DAGGYVPKQVIAFLNNDHNRAQLRGVIAAGNTNFGAEFCYAGDVVSRKCSVPYLYRFELM
GTEDDVAAVRTGLAEFWKEQTCHQPSLQSL
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atggatatcgcggggcgcagcctggtctatttctccagcgtgtcggagaacacccaccgc
tttgtgcagaaactgggtattcccgccacgcggataccgctgcatggccggatcgaggtc
gacgagccgtacgtgctgatactgcccacctacggtggcggccgggccaacccgggtctc
gatgccggcggatacgtccccaaacaggtcattgccttcttgaacaacgaccacaatcga
gcgcagctgcgcggggtcatcgctgccggcaataccaacttcggtgccgagttctgctac
gccggcgacgtcgtctcccgaaaatgtagcgttccctacctataccgcttcgaactgatg
ggcaccgaggacgacgtcgccgccgtccgcaccggtctcgctgaattctggaaggaacag
acgtgccaccaaccgtcattgcagagcctgtag

DBGET integrated database retrieval system