KEGG   Mycobacterium africanum: MAF_30600Help
Entry
MAF_30600         CDS       T01575                                 

Gene name
nrdH
Definition
(GenBank) putative glutaredoxin electron transport component of NRDEF (glutaredoxin-like protein) NRDH
  KO
K06191  
glutaredoxin-like protein NrdH
Organism
maf  Mycobacterium africanum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3393659..3393898)
Genome map
AA seq 79 aa AA seqDB search
MTVTVYTKPACVQCSATSKALDKQGIAYQKVDISLDSEARDYVMALGYLQAPVVVAGNDH
WSGFRPDRIKALAGAALTA
NT seq 240 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtgaccgtttacactaagcccgcgtgcgtacagtgcagtgccacctccaaggcg
ctggacaagcagggcatcgcctaccagaaggttgatatcagcctggattccgaagcgcgg
gactacgtgatggcgctgggttacctacaagcacccgtcgtggtcgccggaaacgaccac
tggtcgggtttccgccccgatcgcatcaaggcgctcgccggggcagcgctgaccgcctag

DBGET integrated database retrieval system