KEGG   Mycobacterium africanum: MAF_30610Help
Entry
MAF_30610         CDS       T01575                                 

Definition
(GenBank) conserved hypothetical protein
Organism
maf  Mycobacterium africanum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3394361..3394915)
Genome map
AA seq 184 aa AA seqDB search
MSDTKSDIKILALVGSLRAASFNRQIAELAAKVAPDGVTVTMFEGLGDLPFYNEDIDTAT
EVPAPVSALREAASDAHAALVVTPEYNGSIPAVIKNAIDWLSRPFGDGALKDKPLAVIGG
SMGRYGGVWAHDETRKSFSIAGTRVVDAIKLSVPFQTLGKSVADDAGLAANVRDAVGNLA
AEVG
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
gtgtcagataccaagtccgacatcaaaatcttggccttagtgggaagcctgcgcgcggcg
tcgttcaaccgccagatcgccgagctggctgccaaggtcgctccggacggcgtcaccgtc
accatgttcgaggggctgggggacctgccgttctacaacgaagacatcgacacagcgacg
gaggtgccggcgccggtgagcgcgttgcgggaggccgcgtctgacgcgcacgctgccttg
gtggtcacgccggaatacaacggcagcattccggccgtgatcaagaacgcgatcgactgg
ctgtccaggccattcggcgatggcgcgttgaaggacaagccgttggccgtgatcggcggc
tccatgggccgctacggcggggtatgggcgcacgacgagactcgcaagtcgttcagcatc
gctggcacgcgggtggtcgatgcgatcaaactgtcggtgccgttccaaactctgggcaag
tcggtcgcggacgacgccgggctggcggcgaatgtgcgcgacgccgtcggcaacttggcc
gctgaggtcggctga

DBGET integrated database retrieval system