KEGG   Mycobacterium africanum: MAF_30650Help
Entry
MAF_30650         CDS       T01575                                 

Definition
(GenBank) putative transcriptional regulatory protein (probably TETR-family)
Organism
maf  Mycobacterium africanum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3397652..3398302)
Genome map
AA seq 216 aa AA seqDB search
MTSHAADEKQAAPPMRRRGDRHRQAILRAARELLEETPFAELSVRAISLRAGVARSGFYF
YFDSKYSVLAQILAEATEELEEASQHFSARQPGESPEQFVNRMIGSVAAVYANNDPVLRA
CNAARQSDMEIRDILERQFQVLLRETIGVFEAEVKAGTAHPISEDLPTLVRTLAATTALM
LTGDALLVGPDSDAARRVRVLEQMWLNALWGGGKAP
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
gtgaccagtcatgccgcagacgagaagcaggctgcgccgccgatgcgacggcgtggtgac
aggcatcgccaggcgattctgcgggccgcacgcgaactgctggaggagacaccgttcgcg
gaattgtcggtgcgcgctatcagccttcgcgcaggggtagcccgctccggtttctacttc
tacttcgattccaaatactcggtgctcgcccagatcttggccgaggccaccgaagaactc
gaagaagccagccagcatttctccgcccgtcagccaggggagtcacccgagcagttcgtc
aaccggatgatcggcagcgtcgccgccgtttacgcgaacaacgacccggtgctgcgggcc
tgtaatgcggcacgccagagcgacatggagatccgcgatattctcgagcggcagttccaa
gtgctgttgcgtgaaaccatcggcgtcttcgaggctgaggtgaaggccggcactgcgcat
ccgatcagcgaagacctcccgacgctcgtccgcaccctggcagctaccaccgcgctgatg
ctgaccggtgacgctttgctcgtcggccccgacagtgacgcagcgcgccgggttcgggtg
cttgaacagatgtggctcaacgcgctttggggtggcggcaaggccccatag

DBGET integrated database retrieval system