KEGG   Mycobacterium africanum: MAF_30850Help
Entry
MAF_30850         CDS       T01575                                 

Gene name
hab
Definition
(GenBank) putative hydroxylaminobenzene mutase HAB
  KO
K01865  
(hydroxyamino)benzene mutase [EC:5.4.4.1]
Organism
maf  Mycobacterium africanum
Pathway
Aminobenzoate degradation
Brite
KEGG Orthology (KO) [BR:maf00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    MAF_30850 (hab)
Enzymes [BR:maf01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.4  Transferring hydroxy groups
    5.4.4.1  (hydroxyamino)benzene mutase
     MAF_30850 (hab)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3420347..3420748
Genome map
AA seq 133 aa AA seqDB search
MQKLLFTIGLALFLIGLLTGLVIPALKNPRMALSSHLEGVLNGMFLVVLGLLWPHIDLPE
AWQVIAVALIVYSAYANWLATLLAAAWGAGRKFAPIATGDHKAPAAKEGFVSFLLLSLSV
AIVIGVVIVIIGL
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
ttgcagaagctgctattcaccatcgggttggccctgttcctgatcggcctgcttaccgga
ttggtcatcccggcactgaagaacccgcgcatggcgctgtcgagccacctcgagggggtc
ctcaacgggatgttcctcgtcgtgctcggcctgctctggccgcacatcgatctgcccgag
gcatggcaggttatcgcggtggcgctgatcgtttactccgcctacgccaactggctggcg
accctgctcgcggcggcctggggagcgggccgtaaattcgcgcccatcgcgaccggcgac
cacaaagccccggccgccaaggagggattcgtcagctttctgttgttgtccctctcggtg
gccatcgtgatcggcgtggtcatcgtcatcattggcctctga

DBGET integrated database retrieval system