KEGG   Mycobacterium africanum: MAF_30880Help
Entry
MAF_30880         CDS       T01575                                 

Definition
(GenBank) conserved hypothetical protein
Organism
maf  Mycobacterium africanum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3425034..3426272
Genome map
AA seq 412 aa AA seqDB search
MTPHYRQAAASRLDTHRTQKLRSQTNGGKDRHQLTYEQFARMLTLMGPSDLWTVERAARH
WGVSASRARAILSSRHIHRVSGYPAQAIKAVTLRQGARTDLKTANHLVPAAQAFTMAETG
AAIGETEDERARLRIFFEFLRGADETGTSALDLIVDEPALIGEHRFDALLAAAAEYISAR
WGRPGPLWSVSIERFLDTAWWVSDLPSARAFAAVWTPAPFRRRGIYLDRHDLTSDGVCVM
PEPVFNRTELQRAFTALAAKLERRGVVGQVHVVGGAAMLLAYNSRVTTRDIDALFSTDGP
MLEAIREVADEMGWPRTWLNNQASGYVSRTPGEGAPVFDHPFLHVVATPAQHLLAMKVVA
ARGVRDGEDIRLLLDRLRITSAAGVWEIVARYFPAETITDRSRLLVEDLLNQ
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
gtgaccccacactatcgccaagccgcggcgtcgcggctcgatacccaccgcacgcaaaag
ctccgttcccagaccaacggagggaaggaccggcaccagttgacatacgagcagttcgct
cgtatgttgacgctgatggggccgagcgatctgtggacggtggaacgcgcggcgcgccat
tggggcgtgagcgcgtcgcgcgctcgcgctatcctgtcgagccgccacattcaccgggtc
agcggctaccccgcgcaggcgatcaaggcggtcaccctgcgccagggtgcgcgcaccgac
ctcaaaaccgccaaccatctcgtgccggccgcacaagcgttcaccatggccgagacgggt
gccgcgatcggagagaccgaagatgagcgggcacgactgcgcattttcttcgagttcctc
cgcggcgccgatgagaccgggacatccgcgctcgatctcatcgttgacgagcccgcgctg
atcggtgagcaccggttcgatgctttgttggccgcggctgcggaatacatttcggcgcgc
tggggccggcctggacccttgtggtcggtgagtatcgaacggtttctggacacggcctgg
tgggtcagcgacctcccgtcggcacgagcgtttgccgccgtgtggacgccggcgccgttc
cggcgccgcggcatttacctagatcgccacgacctcacgagcgatggagtgtgtgtcatg
cccgaaccggtgttcaaccgaaccgagctccagcgggcgttcactgccctggcggccaag
ctggaacgcagaggcgttgtcggtcaggtgcacgttgtcggcggggcggcgatgctactc
gcctacaactcccgtgtcaccactcgcgatatcgacgcgttgttctcaactgacgggcct
atgctcgaagcgattcgtgaggtcgctgacgaaatgggttggccgcgaacgtggctcaac
aatcaggccagcggttacgtctcccgcacaccaggtgaaggcgcccccgttttcgatcac
ccattcctgcatgtcgtagccacacccgcgcagcaccttctcgcgatgaaagtcgttgcg
gcacgcggcgtgcgtgacggcgaagacattcgcctcctgctcgatcggctgcgaatcacc
agcgcggccggcgtatgggagattgtcgcacgctactttcccgccgaaaccatcaccgac
cggtcgaggctcctcgtcgaggacctcctcaaccaatag

DBGET integrated database retrieval system