KEGG   Mycobacterium africanum: MAF_30910Help
Entry
MAF_30910         CDS       T01575                                 

Gene name
lipR
Definition
(GenBank) putative acetyl-hydrolase/esterase LIPR
Organism
maf  Mycobacterium africanum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3428991..3429917
Genome map
AA seq 308 aa AA seqDB search
MNLRKNVIRSVLRGARPLFASRRLGIAGRRVLLATLTAGARAPKGTRFQRVSIAGVPVQR
VQPPHAATSGTLIYLHGGAYALGSARGYRGLAAQLAAAAGMTALVPDYTRAPHAHYPVAL
EEMAAVYTRLLDDGLDPKTTVIAGDSAGGGLTLALAMALRDRGIQAPAALGLICPWADLA
VDIEATRPALRDPLILPSMCTEWAPRYVGSSDPRLPGISPVYGDMSGLPPIVMQTAGDDP
ICVDADKIETACAASKTSIEHRRFAGMWHDFHLQVSLLPEARDAIADLGARLRGHLHQSQ
GQPRGVVK
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaacctgcgcaaaaacgtcatccggtccgtattacgtggtgcccggccactgttcgct
tcccgccggctgggtattgccggccgtcgagtcctgctggcgacgctgacggccggcgcg
cgcgcccccaagggcacccgctttcagcgcgtcagcatcgccggtgtcccggtccagcgg
gtgcaacccccccatgcggcaaccagcgggacgctgatctacctgcacggcggtgcctac
gccctgggcagcgcccggggctaccgcggcctggccgcccagctcgcggcggcggccgga
atgacggcgctggtccccgactacacccgcgcaccgcacgcccactatccagtggccctc
gaagagatggctgcggtgtacacccgcttgctcgacgacgggctcgacccgaaaacgacc
gtcatcgccggtgattcggctggcggagggttgaccctggcgctggccatggcgctgcgc
gatcgcggcatccaggccccggccgcactcggcctgatctgcccgtgggccgatctcgcc
gtcgacatcgaagcgacgcgaccggcgctgcgcgatccgctcattcttccgtcgatgtgc
accgaatgggcgccgcgctacgtagggtcctccgatccgcggctgcccggtatctccccg
gtctacggcgacatgagcggcctgccgcccatcgtcatgcagaccgcgggcgacgatccg
atctgcgtcgacgcggacaagatcgaaaccgcctgcgccgcttcgaaaacaagcatcgag
catcgccggttcgcgggcatgtggcacgacttccatctgcaggtcagtctgctccccgaa
gcccgcgacgcgatcgccgacctcggggcaaggctgcgcggccacctccaccaatcgcag
ggacaaccacggggagtagtcaaatga

DBGET integrated database retrieval system