KEGG   Mycobacterium africanum: MAF_31030Help
Entry
MAF_31030         CDS       T01575                                 

Definition
(GenBank) conserved hypothetical protein
Organism
maf  Mycobacterium africanum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3443541..3444680
Genome map
AA seq 379 aa AA seqDB search
MHRRTALKLPLLLAAGTVLGQAPRAAAGEPGRWSADRAHRWYQAHGWLVGANYITSNAIN
QLEMFQPGTYDPRRIDNELGLARFHGFNTVRVFLHDLLWAQDAPGFQTRLAQFVAIAARY
HIKPLFVLFDSCWDPLPRPGRQRAPRAGVHNSGWVQSPGAERLDDRRYASTLYNYVTGVL
GQFRNDDRVLGWDLWNEPDNPARVYRKVERKDKLERVAELLPQVFRWARTVDPVQPLTSG
VWQGNWGDPGRRSTISAIQLDNADVITFHSYAAPAEFEGRIAELAPLQRPILCTEYLARS
QGSTVEGILPIAKRHNVGAFNWGLVAGKTQTYLPWDSWDHPYRAPPKVWFHDLLHPNGRP
YRDGEVQTIRKLNGMPSQD
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
gtgcaccgtcgaacggccctgaagctcccgctgctgctggcggcaggcacggtgctgggc
caagcgccgcgggccgccgccggagaaccaggccggtggtcggccgaccgcgcacatcgc
tggtatcaagcgcacggctggctcgtcggtgcaaactacatcacctcgaacgccatcaac
cagctcgagatgttccagccaggcacatacgatccccggcgcatcgacaacgagctgggc
cttgcgcggtttcacgggttcaacaccgtgcgagtcttcctccacgacctgctgtgggcc
caagacgcgcccggtttccaaacccggctcgcgcagttcgtcgccatcgcggcgcgatac
cacatcaaaccgctctttgtcctgttcgactcctgctgggacccgctccccagaccgggt
cggcagcgggcgccaagggctggggtgcacaactccgggtgggtgcaaagtccgggtgct
gaacgcctcgatgaccgccgctatgccagcacgctgtacaactacgtcacgggtgtgttg
ggccaattccgcaacgacgatcgcgtgttgggttgggacctgtggaatgaacccgacaat
cccgcgcgcgtgtatcgcaaggtggaaaggaaagacaagctcgagcgcgtcgcggagctc
ctcccccaagtgttccgatgggcccgcacggtcgatccggttcaaccgctgaccagtggt
gtctggcaagggaattggggagatcccggacgccgcagcaccatcagcgccattcaactc
gacaacgccgacgtgatcaccttccacagttacgccgcgccggccgaattcgagggccgc
atcgctgagctcgctccgttgcagcggccaatcctgtgcaccgagtacctggcgcggtcc
caaggcagcactgtcgagggaatcctgccgattgctaagcggcacaacgttggtgcgttc
aattggggtttggtggcgggaaagactcagacctatttgccgtgggattcgtgggatcac
ccctaccgcgcgcccccgaaggtgtggtttcacgacctgctacaccccaacggccggccg
tatcgggacggcgaagttcaaacgattcggaagctgaacgggatgccgagccaggactag

DBGET integrated database retrieval system