KEGG   Mycobacterium africanum: MAF_31050Help
Entry
MAF_31050         CDS       T01575                                 

Definition
(GenBank) hypothetical protein
Organism
maf  Mycobacterium africanum
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3446204..3446656)
Genome map
AA seq 150 aa AA seqDB search
MASLRIAEVDPVDRSPNHHASGSVETSSSRSRSASVRACLIHTSRSSSCSARRMTSLLRS
PLRIAALMICSSFSVGRKPMVAVMSTTIADVAQSYSNCSTHSGTPTPAFAASFLLDAINA
PRVIAGRFASESVRFPAAAPHGSVPSRLPV
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
gtggcctcgcttcgcatcgccgaagtcgaccctgtagaccgctccccgaatcaccacgcg
tccggttcagtggagacatcctcgtctcgaagtcgctcagcgtcggtgcgagcttgcttg
atccacacttcccgttcgagcagctgcagtgcccgccggatgacgtcgctcttgcgctcg
ccgctgcgcattgcggccttgatgatctgctcgtctttttcagtaggtcggaagccgatg
gtcgcggtcatgagtacgacgatagctgatgttgcacaatcgtatagcaattgttcaacg
catagcggcaccccaacgcccgcgttcgccgcctcattccttcttgacgccatcaacgcc
ccgcgcgtaatcgcaggtcgttttgcgtcggagagtgttcgattcccggcggctgcacca
cacggatcggtgccgtcacgtttgccggtctaa

DBGET integrated database retrieval system