KEGG   Mycobacterium africanum: MAF_31070Help
Entry
MAF_31070         CDS       T01575                                 

Gene name
smpB
Definition
(GenBank) putative SSRA-binding protein SMPB
  KO
K03664  
SsrA-binding protein
Organism
maf  Mycobacterium africanum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3448295..3448777)
Genome map
AA seq 160 aa AA seqDB search
MSKSSRGGRQIVASNRKARHNYSIIEVFEAGVALQGTEVKSLREGQASLADSFATIDDGE
VWLRNAHIPEYRHGSWTNHEPRRNRKLLLHRRQIDTLVGKIREGNFALVPLSLYFAEGKV
KVELALARGKQARDKRQDMARRDAQREVLRELGRRAKGMT
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
gtgtccaagtcgtcgcgtggcggccggcagatcgttgccagcaatcgcaaagcccggcac
aactattcgatcatcgaggtgttcgaggccggggttgcgctgcaaggcacggaggtgaag
agcctgcgggaagggcaggcgtcgctggccgattcgttcgccaccatcgacgacggcgaa
gtgtggctgcgcaacgcgcacatcccggaataccggcacggcagctggaccaaccacgag
ccgcgacgcaaccgcaaactgctgttgcatcgccgccagatcgacaccttggtcggcaag
atccgcgaaggcaacttcgccctggtgccgttgtcgctgtatttcgccgaaggcaaggtc
aaggttgagcttgcgctggcccgaggcaagcaagcccgcgacaaacgccaggacatggcc
cgtcgtgatgcccagcgtgaagtgctccgcgagttgggtcggcgcgctaagggcatgacc
tga

DBGET integrated database retrieval system