KEGG   Mycobacterium africanum: MAF_33290Help
Entry
MAF_33290         CDS       T01575                                 

Gene name
sdhD
Definition
(GenBank) putative succinate dehydrogenase (hydrophobic membrane anchor subunit) SDHD (succinic dehydrogenase)
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
maf  Mycobacterium africanum
Pathway
maf00020  Citrate cycle (TCA cycle)
maf00190  Oxidative phosphorylation
maf00650  Butanoate metabolism
maf01100  Metabolic pathways
maf01110  Biosynthesis of secondary metabolites
maf01120  Microbial metabolism in diverse environments
maf01130  Biosynthesis of antibiotics
maf01200  Carbon metabolism
Module
maf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
maf_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
maf_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:maf00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MAF_33290 (sdhD)
   00650 Butanoate metabolism
    MAF_33290 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    MAF_33290 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: CCC28399
UniProt: F8M6Y3
Position
3684978..3685412
Genome map
AA seq 144 aa AA seqDB search
MSAPVRQRSHDRPASLDNPRSPRRRAGMPNFEKFAWLFMRFSGVVLVFLAIGHLFIMLMW
DNGVYRLDFNFVAQRWASPFWQTWDLLLLWLAQLHGGNGLRTIIDDYSRKDTTRFWLNSL
LVLSMLFTLMLGTYVIVTFDPNIS
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccccggtcagacagcgcagccatgaccgtccagccagcctggacaacccacga
tcaccacggcggcgtgccggcatgcccaacttcgagaaattcgcctggctgttcatgcgg
ttttccggtgttgtgttggtgttcctggcgatcgggcacctgttcatcatgctgatgtgg
gacaacggcgtgtatcgcctggacttcaacttcgttgcccaacgctgggcgtcgccgttc
tggcagacctgggatctgctgttgttgtggctggcgcagctgcacggcggcaacggtctg
cgcaccatcattgacgactacagccgcaaagacaccacccgattctggctgaactcgttg
ctggtgttgtccatgctgttcaccctgatgctgggaacctacgtgatagtgacattcgac
ccgaacatctcctga

DBGET integrated database retrieval system