KEGG   Mycobacterium africanum: MAF_34230Help
Entry
MAF_34230         CDS       T01575                                 

Gene name
choD
Definition
cholesterol oxidase (EC:1.1.3.6)
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
maf  Mycobacterium africanum
Pathway
Steroid degradation
Brite
KEGG Orthology (KO) [BR:maf00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    MAF_34230 (choD)
Enzymes [BR:maf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     MAF_34230 (choD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3810526..3812262)
Genome map
AA seq 578 aa AA seqDB search
MKPDYVVLIIGSGFGGSVTALRLTEKGYRVGVLEAGRRFSDEEFAKTSWDLRKFLWAPRL
GCYGIQRIHPLRNVMILAGAGVGGGSLNYANTLYVPPEPFFADQQWSHITDWRGELMPHY
QQAQRMLGVVQNPTFTDADRIVKEVADEMGFGDTWVPTPVGVFFGPDGTKTPGKTVPDPY
FGGAGPARTGCLECGCCMTGCRHGAKNTLVKNYLGLAESAGAQVIPMTTVKGFERRSDGL
WEVRTVRTGSWLRRDRRTFTATQLVLAAGTWGTQHLLFKMRDRGRLPGLSKRLGVLTRTN
SESIVGAATLKVNPDLDLTHGVAITSSIHPTADTHIEPVRYGKGSNAMGLLQTLMTDGSG
PQGTDVPRWRQLLQTASQDPRGTIRMLNPRQWSERTVIALVMQHLDNSITTFTKRGKLGI
RWYSSKQGHGEPNPTWIPIGNQVTRRIAAKIDGVAGGTWGELFNIPLTAHFLGGAVIGDD
PEHGVIDPYHRVYGYPTLYVVDGAAISANLGVNPSLSIAAQAERAASLWPNKGETDRRPP
QGEPYRRLAPIQPAHPVVPADAPGALRWLPIDPVSNAG
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atgaagccggattacgtcgtcctgattattggatcgggtttcgggggcagcgtcaccgcg
ctgcggctgacggaaaagggctaccgggtcggcgtgctggaggccggccgccggttctcc
gacgaggagttcgccaagacgtcgtgggacctgcgcaagtttctctgggcgccgaggttg
ggctgctatggcattcaacgtatccacccgctgcgcaacgtgatgatcctggccggcgcc
ggggtgggcgggggctccctcaactacgccaacacgttgtacgtgccgccggagccgttc
ttcgccgaccagcagtggtcacacatcaccgactggcgtggcgagctgatgccgcactac
cagcaggcgcagcggatgctcggggtggtgcaaaacccgaccttcaccgacgccgaccgc
atcgtcaaggaggtcgccgacgagatggggtttggcgacacctgggtgccgaccccggtt
ggagtgttcttcggccccgacggcaccaagacgcccggcaagaccgtgcccgatccctac
ttcggcggtgccgggccggcgcgcaccggctgcctggaatgcggctgctgtatgacgggc
tgtcgccacggtgccaagaacaccctggtgaaaaactaccttggcctcgcggaatcagct
ggcgcgcaagtgattccgatgaccacggtgaaggggtttgagcggcggtccgacgggttg
tgggaggtccgcacagtgcgaaccggcagttggctgcgccgggatcggcgcaccttcacc
gcaacgcagctggtgctggccgcgggcacctgggggacccagcatctgctgttcaagatg
cgggataggggtcggctccctggtctctcgaagcgattgggtgtccttacccgcaccaac
tcagaatcgatcgtcggggccgccaccttgaaggtcaatccggacctggacctgacccac
ggcgtggcgatcacgtcgtcgattcacccgacggccgacacccacatcgaacccgtgcgc
tacggcaaaggctccaacgcgatggggctgctgcagaccttgatgaccgacggctccggt
ccgcagggcaccgatgtgccgcgctggaggcagttgctgcagaccgccagtcaggatccg
cgcggcaccatccggatgctcaatccccggcaatggagcgagcgcaccgtgatcgcgctg
gtcatgcagcacctggacaactcgatcaccacgttcaccaagcgcgggaagctgggtatc
cgctggtactcgagcaagcagggacacggcgagccgaaccctacatggatcccgatcggc
aaccaggtcacccgtcgcatcgccgccaaaatcgacggcgtggccggcggcacctggggt
gagctgttcaacatcccgctcaccgcgcactttctcggcggcgcggtgatcggcgacgac
cccgagcacggcgtcatcgacccctatcaccgggtctatggctatccgacgctgtacgtg
gttgacggtgcggcgatctcggcgaacctgggtgtcaacccgtcgctgtccatcgccgct
caagccgagcgggccgcctcgctgtggccgaacaagggcgaaaccgaccggcggccaccg
cagggtgagccctatcgtcggctggcgccgatccaaccggcgcacccggtggtgcctgcc
gacgccccgggcgcgctgcggtggttgccgatcgatccggtcagcaacgcgggctga

DBGET integrated database retrieval system