KEGG   Mycobacterium africanum: MAF_35580Help
Entry
MAF_35580         CDS       T01575                                 

Gene name
fadA5
Definition
(GenBank) putative acetyl-CoA acetyltransferase FADA5 (acetoacetyl-CoA thiolase)
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
maf  Mycobacterium africanum
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:maf00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MAF_35580 (fadA5)
   00630 Glyoxylate and dicarboxylate metabolism
    MAF_35580 (fadA5)
   00640 Propanoate metabolism
    MAF_35580 (fadA5)
   00650 Butanoate metabolism
    MAF_35580 (fadA5)
  Lipid metabolism
   00071 Fatty acid degradation
    MAF_35580 (fadA5)
   00072 Synthesis and degradation of ketone bodies
    MAF_35580 (fadA5)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MAF_35580 (fadA5)
   00310 Lysine degradation
    MAF_35580 (fadA5)
   00380 Tryptophan metabolism
    MAF_35580 (fadA5)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MAF_35580 (fadA5)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MAF_35580 (fadA5)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    MAF_35580 (fadA5)
Enzymes [BR:maf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MAF_35580 (fadA5)
Exosome [BR:maf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MAF_35580 (fadA5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3967409..3968584
Genome map
AA seq 391 aa AA seqDB search
MGYPVIVEATRSPIGKRNGWLSGLHATELLGAVQKAVVDKAGIQSGLHAGDVEQVIGGCV
TQFGEQSNNISRVAWLTAGLPEHVGATTVDCQCGSGQQANHLIAGLIAAGAIDVGIACGI
EAMSRVGLGANAGPDRSLIRAQSWDIDLPNQFEAAERIAKRRGITREDVDVFGLESQRRA
QRAWAEGRFDREISPIQAPVLDEQNQPTGERRLVFRDQGLRETTMAGLGELKPVLEGGIH
TAGTSSQISDGAAAVLWMDEAVARAHGLTPRARIVAQALVGAEPYYHLDGPVQSTAKVLE
KAGMKIGDIDIVEINEAFASVVLSWARVHEPDMDRVNVNGGAIALGHPVGCTGSRLITTA
LHELERTDQSLALITMCAGGALSTGTIIERI
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgggttacccggtcatcgttgaagccacccgcagccccatcggcaaacgcaacggatgg
ctgtcggggctgcatgccaccgagttgttgggcgcggtgcaaaaggcggtggtcgacaag
gccggcatccagtccggccttcacgccggtgacgtcgaacaggtcatcggcggttgcgtg
acccagttcggggagcaatccaacaacatcagccgggtggcctggctgacggccggtttg
cccgaacacgtcggcgccaccaccgtcgactgccagtgcggcagcggccagcaggccaac
catctgattgccgggttgatcgcggccggtgccatcgatgtcggcatcgcctgcggcatc
gaggcgatgagccgggtcgggctgggcgccaacgccgggccggaccgctcgctgatccgc
gcgcagtcatgggatatcgacctgccgaaccagttcgaggccgccgagcggatcgccaag
cggcgcggcatcacccgcgaggacgtggatgtcttcgggctcgagtcgcagcgacgcgcg
cagcgggcctgggcggagggccgctttgaccgcgagatctcgccgatccaggcgccggtg
ctcgacgagcagaatcagcccaccggcgagcggcgcctggtctttcgcgaccagggcctg
cgcgagaccacgatggcggggctaggcgagctgaaaccggtgctcgagggcggcatccac
accgcgggcacgtcgtcgcagatctccgacggcgcggcagccgtgttgtggatggacgaa
gccgtggcacgtgcgcacggcctgaccccgcgggcccggatcgtcgcccaggcactcgtc
ggcgccgagccctactaccacctggacggcccggtgcagtccaccgcgaaggtgctggag
aaggccggcatgaagatcggcgacatcgacatcgtcgagatcaacgaggcgttcgcgtcc
gtggtgctgtcctgggcgcgggtgcacgagcccgacatggaccgggtcaacgtcaacggc
ggggcgatcgcgctggggcatccggtgggctgcaccggcagccggctgatcaccaccgcc
ctgcacgagctcgagcgcaccgaccagagcctcgcgctgatcaccatgtgcgccggcggg
gccctgtccaccggcaccatcatcgagcggatttaa

DBGET integrated database retrieval system