KEGG   Magnetospirillum magneticum: amb0632Help
Entry
amb0632           CDS       T00305                                 

Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
mag  Magnetospirillum magneticum
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:mag03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
680854..681780
Genome map
AA seq 308 aa AA seqDB search
MRVAVGHGAAPYRGNSSLSRGGACLILPAMPELPEVETVARGLAQVWDGRRFVSVETRRA
GLRVPFPKDFARRLTGRTVEAVGRRAKYLVVRLDGGLVMLGHLGMSGRMTIGALRNEPPG
PHDHVEWVTDQGISVTLTDPRRFGLFALCEASDLGGHPLLAGIGPEPLDEAFDAGVLAKA
LAGKTGPIKTVLLDQKVVAGLGNIYVCESLFRAEISPLRPAGSLSRAEVGRLVPLIKAVL
SEAVAAGGSTLRDHARPDGELGYFQHSFQVYGREGETCPGCPGAPACGGILRMTQAGRST
FYCAKRQR
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgagagtggctgtcggtcatggggcggcaccttatcgcggaaattcgtcgctgtcacgg
ggcggagcctgccttatactccccgccatgcctgaattgcccgaagtcgaaaccgtcgcc
cgtggtctggcccaagtgtgggacgggcggcgctttgtctcggtcgagacgcggcgtgcc
ggactgcgcgtgccgttccccaaggatttcgcccggcgcctgaccggccggacggtggag
gcggtggggcgccgggccaagtatctggtggtgcgcctcgacggaggcctggtcatgctg
ggtcatctcggcatgtcggggcgcatgaccatcggcgccctgcgcaacgagccgcccggt
ccccacgaccatgtggagtgggtgacggaccaggggatcagcgtgacgctcaccgatccc
cgccgtttcgggctgttcgccctgtgcgaggcgtcggacctgggcggtcatccgctgctg
gccgggatcgggccagagcctctggacgaagccttcgacgccggcgtcctggccaaggcc
ctggccggcaagaccggccccatcaagacggtgctgctggaccagaaggtggtggcgggg
ctgggcaacatctatgtgtgcgaaagcctgttccgggcggagatctcgccgctgcgcccc
gccggctccctgagccgggccgaggtggggcgtctggtgccgctgatcaaggcggtgctg
agcgaagctgtggcggcgggcggctccacccttcgcgaccacgcccggcccgacggcgag
ctgggctatttccagcattcctttcaggtctatgggcgcgagggcgagacctgccccggc
tgccccggggcgccggcctgcggcggcatcttgcgcatgacccaggcgggtcgctccact
ttctattgtgcgaagcggcaaaggtga

DBGET integrated database retrieval system